LXL04_007452 | RubberDandelionOmics

Gene overview

LXL04_007452

Reference: OH-1004 Chr: Chr02 Coordinates: 48929443-48932085 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1089 bp · LXL04_007452|LXL04_007452|OH1004|cDNA

ATGCTCGATAGTAGATACTATTCCCTATGTCGCTCGGATTCTTGCTCCTTCAACAGAGCTATCTTCCTCCTTCTTCCCTGCTTTCATATCAAGTTGGTGGAAATGTCGTTACAGTGTATTGGATTAAATATGTTGCCATTTTCCCAATCTGTATATGCAAAAGAGAACGTATTAAAAGCTAATCTTTCCTTCACTAAGGAGCCTTTTACAAGCATTCAGTTTCCAAGATCACTATTCCTGGCACGAACTTTGCAAAAAAG...

CDS

Download CDS FASTA

1089 bp · LXL04_007452|LXL04_007452|OH1004|CDS

ATGCTCGATAGTAGATACTATTCCCTATGTCGCTCGGATTCTTGCTCCTTCAACAGAGCTATCTTCCTCCTTCTTCCCTGCTTTCATATCAAGTTGGTGGAAATGTCGTTACAGTGTATTGGATTAAATATGTTGCCATTTTCCCAATCTGTATATGCAAAAGAGAACGTATTAAAAGCTAATCTTTCCTTCACTAAGGAGCCTTTTACAAGCATTCAGTTTCCAAGATCACTATTCCTGGCACGAACTTTGCAAAAAAG...

Protein

Download Protein FASTA

362 aa · LXL04_007452|LXL04_007452|OH1004|PROTEIN

MLDSRYYSLCRSDSCSFNRAIFLLLPCFHIKLVEMSLQCIGLNMLPFSQSVYAKENVLKANLSFTKEPFTSIQFPRSLFLARTLQKSRLRGSKVEILDCDDDKKKESPKSSKKDDDDEDDDDDSDFEMDEEEREEFRKKIRQMIAMNPEVKGVDDPEEKKKMMEKLLSDYPLVVDEEDPDWPEDADGRGFNFSQFFDKMSIKNVKKDDDDGYDSDGEVNWQDIKAIKDIKSEEWEDTVFQDLSPLIVLLHHRYKRPKENE...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007452`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007452

Location Chr02:48929443-48932085 (-)

Description Similar to MRL7L: Thioredoxin-like fold domain-containing protein MRL7L, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g31840`	Plays an essential role in early steps of chloroplast development.	No verified direct reference in this release
`At4g28590`	Plays an essential role in early steps of chloroplast development.	Two novel proteins, MRL7 and its paralog MRL7-L, have essential but functionally distinct roles in chloroplast development and are involved in plastid gene expression regulation in Arabidopsis.2011 · DOI: 10.1093/pcp/pcr054 AtECB1/MRL7, a thioredoxin-like fold protein with disulfide reductase activity, regulates chloroplast gene expression and chloroplast biogenesis in Arabidopsis thaliana.2014 · DOI: 10.1093/mp/sst092 SVR4 (suppressor of variegation 4) and SVR4-like: two proteins with a role in proper organization of the chloroplast genetic machinery.2014 · DOI: 10.1111/ppl.12108 PRDA1, a novel chloroplast nucleoid protein, is required for early chloroplast development and is involved in the regulation of plastid gene expression in Arabidopsis.2013 · DOI: 10.1093/pcp/pct148

Rice

Reference gene ID	Possible function	Papers / DOI
`Os05g0417200`	Plays an essential role in early steps of chloroplast development.	No verified direct reference in this release
`Os01g0829000`	Plays an essential role in early steps of chloroplast development.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007452 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009646 response to absence of light Biological Process

GO:0009658 chloroplast organization Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009570 chloroplast stroma Cellular Component

GO:0042644 chloroplast nucleoid Cellular Component

KEGG gene cross-reference

ath:AT2G31840

ath:AT4G28590

dosa:Os01g0829000

dosa:Os05g0417200

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.952

Rank 1 · LXL04_007452 · OH-1004

Mitochondrion0.045

Rank 2 · LXL04_007452 · OH-1004

Nucleus0.041

Rank 3 · LXL04_007452 · OH-1004

Cytoplasm0.024

Rank 4 · LXL04_007452 · OH-1004

Cell membrane0.015

Rank 5 · LXL04_007452 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

No result was found for this query.

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SKB6`	Arabidopsis thaliana	Thioredoxin-like fold domain-containing protein MRL7L, chloroplastic	59.414%	Swiss-Prot	moderate database homology
`F4JLC1`	Arabidopsis thaliana	Thioredoxin-like fold domain-containing protein MRL7, chloroplastic	44.118%	Swiss-Prot	weak database homology
`Q0DI48`	Oryza sativa subsp. japonica	Thioredoxin-like fold domain-containing protein MRL7L homolog, chloroplastic	53.942%	Swiss-Prot	moderate database homology
`Q5QLS7`	Oryza sativa subsp. japonica	Thioredoxin-like fold domain-containing protein MRL7 homolog, chloroplastic	44.633%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card