TkA03G163120 | RubberDandelionOmics

Gene overview

TkA03G163120

Reference: TK1151 Chr: Chr03 Coordinates: 41377242-41378541 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

765 bp · TkA03G163120|TK1151|cDNA

CTTCCGCTTTCCATTCCAATGTTTCTTCATTTTTCCTACCAAAACAAGTTTCGCAATGCAACCTCCAATTATCTAATTGCCTTCTTTTTTTTTTGAAGAAAGTCTCTCCCAAACTTGTTGATCTCGTTTTTTTGTTATTGGGATTAGAAACAAAAAGGAACAGAAAAGATAAAGGAGAAGAGTATCATCTAGGCAATTAAGATGTTACAAAGGGCGGCTAGCAATGCGTTTTCATGGTGGTGGGCTAGCCATATTCGAAC...

CDS

Download CDS FASTA

564 bp · TkA03G163120|TK1151|CDS

ATGTTACAAAGGGCGGCTAGCAATGCGTTTTCATGGTGGTGGGCTAGCCATATTCGAACCAAGCAATCAAAATGGCTTGAGCAAAGCCTGATAGATATGGAATACAAGGTTGAAAACGCGCTGAATATTATTCAAAAAGATGGAGATTCATTTGGAAAGAGAGCAGAAATGTACTACCGACACCGACCAGATCTAATATGCTTCGTTGAGGAAACATTTCGGGCATACCGATCATTAGCAGAACGTTATGATAAAATGTC...

Protein

Download Protein FASTA

188 aa · TkA03G163120|TK1151|PROTEIN

MLQRAASNAFSWWWASHIRTKQSKWLEQSLIDMEYKVENALNIIQKDGDSFGKRAEMYYRHRPDLICFVEETFRAYRSLAERYDKMSKDLQKANTTIASIFPDQVSYDDFDDFDSPRSIPRNFPPQNQDPNAAKNIPKVPQLPSKNLKGLISNASKKIQLTKAFKEDHRSRIVPKSGLTEEQALEEID

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G163120`
TK1151 ID	TkA03G163120
OH-1004 ID	LXL04_007384
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 20.259 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G163120

Location Chr03:41377242-41378541 (+)

Description Similar to KIP1: Kinase-interacting protein 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10500`	Plant-specific actin binding protein.	No verified direct reference in this release
`At2g22560`	Plant-specific actin binding protein.	No verified direct reference in this release
`At1g58215`	Plant-specific actin binding protein.	No verified direct reference in this release
`At1g09720`	Plant-specific actin binding protein.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007384 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005737 cytoplasm Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0003779 actin binding Molecular Function

GO:0051015 actin filament binding Molecular Function

KEGG gene cross-reference

ath:AT1G09720

ath:AT1G58215

ath:AT2G22560

ath:AT5G10500

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.418

Rank 1 · TkA03G163120 · TK1151

Nucleus0.346

Rank 2 · TkA03G163120 · TK1151

Cell membrane0.129

Rank 3 · TkA03G163120 · TK1151

Mitochondrion0.108

Rank 4 · TkA03G163120 · TK1151

Endoplasmic reticulum0.077

Rank 5 · TkA03G163120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF28649SKIP24_C4-39 aa

PF14154DUF43067-47 aa

PF07765KIP111-84 aa

PF08930DUF191223-79 aa

PF16523betaPIX_CC26-69 aa

PF19320GlfT2_domain359-99 aa

PF27044HAUS3_CC71-104 aa

PF28649SKIP24_C76-91 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G163120	`PF28649`	SKIP24_C	4	39	0.11	13.1
TkA03G163120	`PF14154`	DUF4306	7	47	0.45	11.2
TkA03G163120	`PF07765`	KIP1	11	84	4.5e-34	117.1
TkA03G163120	`PF08930`	DUF1912	23	79	0.078	13.7
TkA03G163120	`PF16523`	betaPIX_CC	26	69	0.32	11.6
TkA03G163120	`PF19320`	GlfT2_domain3	59	99	0.82	10.0
TkA03G163120	`PF27044`	HAUS3_CC	71	104	0.1	13.5
TkA03G163120	`PF28649`	SKIP24_C	76	91	0.11	13.1
TkA03G163120	`PF19320`	GlfT2_domain3	121	159	0.82	10.0
TkA03G163120	`PF07765`	KIP1	158	161	4.5e-34	117.1
TkA03G163120	`PF16523`	betaPIX_CC	159	171	0.32	11.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LPQ1`	Arabidopsis thaliana	sp\|Q8LPQ1\|NET2C_ARATH Protein NETWORKED 2C	56.800%	Swiss-Prot	High
`F4IJK1`	Arabidopsis thaliana	sp\|F4IJK1\|NET2D_ARATH Protein NETWORKED 2D	56.000%	Swiss-Prot	High
`P0DMS1`	Arabidopsis thaliana	sp\|P0DMS1\|NET2A_ARATH Protein NETWORKED 2A	51.000%	Swiss-Prot	High
`F4I131`	Arabidopsis thaliana	sp\|F4I131\|NET2B_ARATH Protein NETWORKED 2B	52.100%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card