TkA03G120650 | RubberDandelionOmics

Gene overview

TkA03G120650

Reference: TK1151 Chr: Chr03 Coordinates: 30841729-30843556 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

525 bp · TkA03G120650|TK1151|cDNA

ATGAGGATGGCGTTCGATGACTGCTACCTGGTTACCGATGGTACACAGACGGTGTGGTGCGCCCAGGTACCCAAAAAAATAAATATTTTCATTTGGAGGGTGCGGAAGTCTAGGTTGTCCACCAAGAAAAACCTTATCGCTAGGAATATAGCGGGTATTTCACCCCTGTGCCCGTTATGCAGCACACAGGAGGAGACGGAAGAACACATTTTTCTCAGGTGTTCCACCACCAGAGTCATTATGGCCAAGCTAAAGGACTG...

CDS

Download CDS FASTA

525 bp · TkA03G120650|TK1151|CDS

ATGAGGATGGCGTTCGATGACTGCTACCTGGTTACCGATGGTACACAGACGGTGTGGTGCGCCCAGGTACCCAAAAAAATAAATATTTTCATTTGGAGGGTGCGGAAGTCTAGGTTGTCCACCAAGAAAAACCTTATCGCTAGGAATATAGCGGGTATTTCACCCCTGTGCCCGTTATGCAGCACACAGGAGGAGACGGAAGAACACATTTTTCTCAGGTGTTCCACCACCAGAGTCATTATGGCCAAGCTAAAGGACTG...

Protein

Download Protein FASTA

174 aa · TkA03G120650|TK1151|PROTEIN

MRMAFDDCYLVTDGTQTVWCAQVPKKINIFIWRVRKSRLSTKKNLIARNIAGISPLCPLCSTQEETEEHIFLRCSTTRVIMAKLKDWWKDLPDLDTVSNIDSLLSHSYPRKSKEKEIWEAVSRAFFWTLWNYRNSLIFDGKVKTTQQLVLDAKFNAFNWLKNRCNSFRHVIWLN

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G120650`
TK1151 ID	TkA03G120650
OH-1004 ID	LXL04_019167
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	51.600
Protein coverage (%)	TK1151 73.563 / OH-1004 26.471 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G120650`
Location	Chr03:30841729-30843556 (-)
Description	Similar to LAX1: Transcription factor LAX PANICLE 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_019167` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0000012 single strand break repair Biological Process GO:0006260 DNA replication Biological Process GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006790 sulfur compound metabolic process Biological Process GO:0009150 purine ribonucleotide metabolic process Biological Process GO:0010197 polar nucleus fusion Biological Process GO:0045893 positive regulation of DNA-templated transcription Biological Process GO:0048586 regulation of long-day photoperiodism, flowering Biological Process GO:0048587 regulation of short-day photoperiodism, flowering Biological Process GO:2000032 regulation of secondary shoot formation Biological Process GO:0005634 nucleus Cellular Component
KEGG gene cross-reference	ath:AT3G21330 ath:AT4G00120 dosa:Os01g0831000 dosa:Os05g0541400 osa:9269440 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.424

Rank 1 · TkA03G120650 · TK1151

Cell membrane0.306

Rank 2 · TkA03G120650 · TK1151

Nucleus0.181

Rank 3 · TkA03G120650 · TK1151

Golgi apparatus0.090

Rank 4 · TkA03G120650 · TK1151

Endoplasmic reticulum0.089

Rank 5 · TkA03G120650 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00626Gelsolin6-39 aa

PF13966zf-RVT15-78 aa

PF13966zf-RVT125-132 aa

PF00626Gelsolin148-165 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G120650	`PF00626`	Gelsolin	6	39	0.12	13.0
TkA03G120650	`PF13966`	zf-RVT	15	78	7.8e-16	59.2
TkA03G120650	`PF13966`	zf-RVT	125	132	7.8e-16	59.2
TkA03G120650	`PF00626`	Gelsolin	148	165	0.12	13.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card