TkA03G117810 | RubberDandelionOmics

Gene overview

TkA03G117810

Reference: TK1151 Chr: Chr03 Coordinates: 30114751-30115717 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

456 bp · TkA03G117810|TK1151|cDNA

ATGGAACATATTCTTTCTAAGCAACAAGGAAGCAGCCTTGAATCACAGGATAGCAGCATACAAGGAGCTAGCAAAGATTTAAAGTGCACACCTTTTCGAACATGTAAGGAGCTTTTACAGACAGTGGACAGGCTTGTTGAAGAGAATAATACCGAGGAGATGTCTGTGGCTGTGACTGATATGACACAACTTGAAAAAGAACTTCATGATGCTCTTATGCAAACACGGTCAATAAAGACCGAGTTGATGACCAAGTACCT...

CDS

Download CDS FASTA

456 bp · TkA03G117810|TK1151|CDS

ATGGAACATATTCTTTCTAAGCAACAAGGAAGCAGCCTTGAATCACAGGATAGCAGCATACAAGGAGCTAGCAAAGATTTAAAGTGCACACCTTTTCGAACATGTAAGGAGCTTTTACAGACAGTGGACAGGCTTGTTGAAGAGAATAATACCGAGGAGATGTCTGTGGCTGTGACTGATATGACACAACTTGAAAAAGAACTTCATGATGCTCTTATGCAAACACGGTCAATAAAGACCGAGTTGATGACCAAGTACCT...

Protein

Download Protein FASTA

151 aa · TkA03G117810|TK1151|PROTEIN

MEHILSKQQGSSLESQDSSIQGASKDLKCTPFRTCKELLQTVDRLVEENNTEEMSVAVTDMTQLEKELHDALMQTRSIKTELMTKYLSTLQAEERKLSEEKEELKQQLQVATTKKKEDGDDGGGDLDDSATNHNHKHPTNQQLFTLPLFKD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G117810`
TK1151 ID	TkA03G117810
OH-1004 ID	LXL04_007133
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	71.600
Protein coverage (%)	TK1151 100.000 / OH-1004 73.333 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G117810`
Location	Chr03:30114751-30115717 (+)
Description	Similar to AGL31: Agamous-like MADS-box protein AGL31
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007133` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006351 DNA-templated transcription Biological Process GO:0006355 regulation of DNA-templated transcription Biological Process GO:0006357 regulation of transcription by RNA polymerase II Biological Process GO:0009266 response to temperature stimulus Biological Process GO:0009908 flower development Biological Process GO:0009910 negative regulation of flower development Biological Process GO:0010048 vernalization response Biological Process GO:0010221 negative regulation of vernalization response Biological Process GO:0030154 cell differentiation Biological Process GO:0042752 regulation of circadian rhythm Biological Process GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process GO:0048440 carpel development Biological Process
KEGG gene cross-reference	ath:AT5G10140 ath:AT5G65050 ath:AT5G65060 vvi:100232867 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.908

Rank 1 · TkA03G117810 · TK1151

Cytoplasm0.196

Rank 2 · TkA03G117810 · TK1151

Cell membrane0.029

Rank 3 · TkA03G117810 · TK1151

Mitochondrion0.019

Rank 4 · TkA03G117810 · TK1151

Endoplasmic reticulum0.016

Rank 5 · TkA03G117810 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23280TPR_265-21 aa

PF27044HAUS3_CC27-62 aa

PF02589LUD_dom33-108 aa

PF06156YabA33-51 aa

PF04108ATG17_like34-110 aa

PF23280TPR_2634-109 aa

PF13874Nup5436-112 aa

PF23921DUF726043-109 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G117810	`PF23280`	TPR_26	5	21	0.028	15.2
TkA03G117810	`PF27044`	HAUS3_CC	27	62	0.021	15.7
TkA03G117810	`PF02589`	LUD_dom	33	108	0.072	13.5
TkA03G117810	`PF06156`	YabA	33	51	1.5	10.1
TkA03G117810	`PF04108`	ATG17_like	34	110	0.0046	17.2
TkA03G117810	`PF23280`	TPR_26	34	109	0.028	15.2
TkA03G117810	`PF13874`	Nup54	36	112	4.4	8.0
TkA03G117810	`PF23921`	DUF7260	43	109	0.011	15.9
TkA03G117810	`PF11740`	KfrA_N	44	116	0.2	13.1
TkA03G117810	`PF28006`	HpsJ	45	115	6.3	7.1
TkA03G117810	`PF27575`	Map3k7cl	47	70	3.7	8.6
TkA03G117810	`PF01486`	K-box	55	108	3.9e-07	30.8
TkA03G117810	`PF07217`	Het-C	57	151	0.23	10.7
TkA03G117810	`PF06156`	YabA	59	118	1.5	10.1
TkA03G117810	`PF27575`	Map3k7cl	60	115	3.7	8.6
TkA03G117810	`PF27044`	HAUS3_CC	68	116	0.021	15.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card