TkA03G117770 | RubberDandelionOmics

Gene overview

TkA03G117770

Reference: TK1151 Chr: Chr03 Coordinates: 30102749-30103275 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

327 bp · TkA03G117770|TK1151|cDNA

ATGGGGCGGAGGAAACTCGAAATAAAGCGAATCGAAGATAAGAGTAGCAGGCGAGTGGCTTTTTCTAAGCGAAGAGCAGGCTTAATCAAGAAAGCAAGGCATCTTTCCGTGGTCTGCGACGTTGATGTCGCCGTTCTTGTATTCTCTGCCACCGGCAAGCTCTATGAATACTGCAGCGGCGGTTCTAACAGCCTAACATCAGCAACACCATGCTTGAATGCTCCAGAATTTGCTGTTATAATCCAATTAGGGTTACTGAG...

CDS

Download CDS FASTA

327 bp · TkA03G117770|TK1151|CDS

ATGGGGCGGAGGAAACTCGAAATAAAGCGAATCGAAGATAAGAGTAGCAGGCGAGTGGCTTTTTCTAAGCGAAGAGCAGGCTTAATCAAGAAAGCAAGGCATCTTTCCGTGGTCTGCGACGTTGATGTCGCCGTTCTTGTATTCTCTGCCACCGGCAAGCTCTATGAATACTGCAGCGGCGGTTCTAACAGCCTAACATCAGCAACACCATGCTTGAATGCTCCAGAATTTGCTGTTATAATCCAATTAGGGTTACTGAG...

Protein

Download Protein FASTA

108 aa · TkA03G117770|TK1151|PROTEIN

MGRRKLEIKRIEDKSSRRVAFSKRRAGLIKKARHLSVVCDVDVAVLVFSATGKLYEYCSGGSNSLTSATPCLNAPEFAVIIQLGLLRCKFIASSNHWSRNQLDTGSLW

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G117770`
TK1151 ID	TkA03G117770
OH-1004 ID	LXL04_007133
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	98.500
Protein coverage (%)	TK1151 60.185 / OH-1004 27.083 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G117770

Location Chr03:30102749-30103275 (+)

Description Similar to AGL31: Agamous-like MADS-box protein AGL31

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g10140`	Putative transcription factor that seems to play a central role in the regulation of flowering time in the late-flowering phenotype by interacting with 'FRIGIDA', the autonomous and the vernalization flowering pathways.	No verified direct reference in this release
`At5g13790`	Transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway.	The MADS-domain protein AGAMOUS-like 15 accumulates in embryonic tissues with diverse origins.1999 · DOI: 10.1104/pp.120.1.121 The embryo MADS domain factor AGL15 acts postembryonically. Inhibition of perianth senescence and abscission via constitutive expression.2000 · DOI: 10.1105/tpc.12.2.183 Effect of regulated overexpression of the MADS domain factor AGL15 on flower senescence and fruit maturation.2002 · DOI: 10.1104/pp.004721 Binding site selection for the plant MADS domain protein AGL15: an in vitro and in vivo study.2003 · DOI: 10.1074/jbc.m212976200 The embryo MADS domain protein AGAMOUS-Like 15 directly regulates expression of a gene encoding an enzyme involved in gibberellin metabolism.2004 · DOI: 10.1105/tpc.021261 Control of expression and autoregulation of AGL15, a member of the MADS-box family.2005 · DOI: 10.1111/j.1365-313x.2004.02320.x The MADS domain factors AGL15 and AGL18 act redundantly as repressors of the floral transition in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03105.x The MADS-domain transcriptional regulator AGAMOUS-LIKE15 promotes somatic embryo development in Arabidopsis and soybean.2008 · DOI: 10.1104/pp.108.115832 Arabidopsis cold shock domain proteins: relationships to floral and silique development.2009 · DOI: 10.1093/jxb/ern351 Global identification of targets of the Arabidopsis MADS domain protein AGAMOUS-Like15.2009 · DOI: 10.1105/tpc.109.068890 The MADS domain protein AGL15 localizes to the nucleus during early stages of seed development.1996 · DOI: 10.1105/tpc.8.11.1977
`At1g77080`	Probable transcription factor involved in the negative regulation of flowering time in both long and short days, probably through the photoperiodic and vernalization pathways.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0883100`	Probable transcription factor involved in the development of floral organs.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007133 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0006357 regulation of transcription by RNA polymerase II Biological Process

GO:0009266 response to temperature stimulus Biological Process

GO:0009908 flower development Biological Process

GO:0009910 negative regulation of flower development Biological Process

GO:0010048 vernalization response Biological Process

GO:0010221 negative regulation of vernalization response Biological Process

GO:0030154 cell differentiation Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0045944 positive regulation of transcription by RNA polymerase II Biological Process

GO:0048440 carpel development Biological Process

KEGG gene cross-reference

ath:AT5G10140

ath:AT5G65050

ath:AT5G65060

vvi:100232867

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.848

Rank 1 · TkA03G117770 · TK1151

Cytoplasm0.198

Rank 2 · TkA03G117770 · TK1151

Cell membrane0.036

Rank 3 · TkA03G117770 · TK1151

Endoplasmic reticulum0.034

Rank 4 · TkA03G117770 · TK1151

Plastid0.022

Rank 5 · TkA03G117770 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00319SRF-TF10-57 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G117770	`PF00319`	SRF-TF	10	57	2.8e-23	81.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9S7Q7`	Arabidopsis thaliana	sp\|Q9S7Q7\|FLC_ARATH MADS-box protein FLOWERING LOCUS C	73.300%	Swiss-Prot	Medium
`Q38847`	Arabidopsis thaliana	sp\|Q38847\|AGL15_ARATH Agamous-like MADS-box protein AGL15	64.200%	Swiss-Prot	Medium
`Q9AT76`	Arabidopsis thaliana	sp\|Q9AT76\|AGL27_ARATH Agamous-like MADS-box protein AGL27	70.000%	Swiss-Prot	Medium
`Q40702`	Oryza sativa subsp. japonica	sp\|Q40702\|MADS2_ORYSJ MADS-box transcription factor 2	62.700%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card