TkA03G108640 | RubberDandelionOmics

Gene overview

TkA03G108640

Reference: TK1151 Chr: Chr03 Coordinates: 27808098-27810217 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

852 bp · TkA03G108640|TK1151|cDNA

ATGTATGACTCGGACTCCCCTTCTTCATATTTCGTTGCTTTCGTCCTTTTGATTCTCATTAAGGTCCCAACCTTTATATGTACCACCGACGCACGATACAAGAGTTGTGGTATCGCATTCGAGTGTGGAACCCTTAGATCCATGAAGTACCCGTTTTGGGGGAAGGACCGCCCTAATTATTGTGGAAAACTAGCTTACAAGCTAGAGTGCGTCAACGACACTATTCCAGTTATTGAAATTAAGTCACTAAAATATCGAGT...

CDS

Download CDS FASTA

852 bp · TkA03G108640|TK1151|CDS

ATGTATGACTCGGACTCCCCTTCTTCATATTTCGTTGCTTTCGTCCTTTTGATTCTCATTAAGGTCCCAACCTTTATATGTACCACCGACGCACGATACAAGAGTTGTGGTATCGCATTCGAGTGTGGAACCCTTAGATCCATGAAGTACCCGTTTTGGGGGAAGGACCGCCCTAATTATTGTGGAAAACTAGCTTACAAGCTAGAGTGCGTCAACGACACTATTCCAGTTATTGAAATTAAGTCACTAAAATATCGAGT...

Protein

Download Protein FASTA

283 aa · TkA03G108640|TK1151|PROTEIN

MYDSDSPSSYFVAFVLLILIKVPTFICTTDARYKSCGIAFECGTLRSMKYPFWGKDRPNYCGKLAYKLECVNDTIPVIEIKSLKYRVFGVNYHDQTITVTRLDYWREICPSRLVNTILDFESFNYTIGTRNLTLGYGCQLPTSHASVLEYPCTINNTKTNVVYAPDFPCNQSVTLPVFENSASDLDLNRTDLVSALDNGFALQWYVEGEQCMNCIQSGGSCGIDPNSHFICYCSDRPYEDICGKPSDMQTEAAKVLTPEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G108640`
TK1151 ID	TkA03G108640
OH-1004 ID	LXL04_007066
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	100.000
Protein coverage (%)	TK1151 99.647 / OH-1004 28.659 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G108640`
Location	Chr03:27808098-27810217 (+)
Description	Similar to LRK10L-1.3: LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_007066` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0042631 cellular response to water deprivation Biological Process GO:0046777 protein autophosphorylation Biological Process GO:0048573 photoperiodism, flowering Biological Process GO:0071215 cellular response to abscisic acid stimulus Biological Process GO:0071456 cellular response to hypoxia Biological Process GO:0005576 extracellular region Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0004674 protein serine/threonine kinase activity Molecular Function GO:0005524 ATP binding Molecular Function GO:0030247 polysaccharide binding Molecular Function GO:0106310 protein serine kinase activity Molecular Function
KEGG gene cross-reference	ath:AT1G18390 ath:AT1G66880 ath:AT5G38210 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.683

Rank 1 · TkA03G108640 · TK1151

Extracellular0.116

Rank 2 · TkA03G108640 · TK1151

Endoplasmic reticulum0.110

Rank 3 · TkA03G108640 · TK1151

Cytoplasm0.106

Rank 4 · TkA03G108640 · TK1151

Nucleus0.068

Rank 5 · TkA03G108640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13947GUB_WAK_bind41-101 aa

PF14380WAK_assoc167-236 aa

PF13947GUB_WAK_bind221-231 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G108640	`PF13947`	GUB_WAK_bind	41	101	1.4e-13	51.7
TkA03G108640	`PF14380`	WAK_assoc	167	236	8.5e-16	59.2
TkA03G108640	`PF13947`	GUB_WAK_bind	221	231	1.4e-13	51.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card