LXL04_007066 | RubberDandelionOmics

Gene overview

LXL04_007066

Reference: OH-1004 Chr: Chr02 Coordinates: 35089102-35100167 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2955 bp · LXL04_007066|LXL04_007066|OH1004|cDNA

ATGTATGACTCGGACTCCCCTTCTTCATATTTCGTTGCTTTCGTCCTTTTGATTCTCATTAAGGTCCCAACCTTTATATGTACCACCGACGCACGATACAAGAGTTGTGGTATCGCATTCGAGTGTGGAACCCTTAGATCCATGAAGTACCCGTTTTGGGGGAAGGACCGCCCTAATTATTGTGGAAAACTAGCTTACAAGCTAGAGTGCGTCAACGACACTATTCCAGTTATTGAAATTAAGTCACTAAAATATCGAGT...

CDS

Download CDS FASTA

2955 bp · LXL04_007066|LXL04_007066|OH1004|CDS

ATGTATGACTCGGACTCCCCTTCTTCATATTTCGTTGCTTTCGTCCTTTTGATTCTCATTAAGGTCCCAACCTTTATATGTACCACCGACGCACGATACAAGAGTTGTGGTATCGCATTCGAGTGTGGAACCCTTAGATCCATGAAGTACCCGTTTTGGGGGAAGGACCGCCCTAATTATTGTGGAAAACTAGCTTACAAGCTAGAGTGCGTCAACGACACTATTCCAGTTATTGAAATTAAGTCACTAAAATATCGAGT...

Protein

Download Protein FASTA

984 aa · LXL04_007066|LXL04_007066|OH1004|PROTEIN

MYDSDSPSSYFVAFVLLILIKVPTFICTTDARYKSCGIAFECGTLRSMKYPFWGKDRPNYCGKLAYKLECVNDTIPVIEIKSLKYRVFGVNYHDQTITVTRLDYWREICPSRLVNTILDFESFNYTIGTRNLTLGYGCQLPTSHASVLEYPCTINNTKTNVVYAPDFPCNQSVTLPVFENSASDLDLNRTDLVSALDNGFALQWYVEGEQCMNCIQSGGSCGIDPNSHFICYCSDRPYEDICGKPSDMQTEAAKVLTPEA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_007066`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_007066

Location Chr02:35089102-35100167 (+)

Description Similar to LRK10L-1.3: LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g38210`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.3.	No verified direct reference in this release
`At1g66880`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.4.	No verified direct reference in this release
`At1g18390`	Probable receptor-like serine/threonine-protein kinase involved in abscisic acid (ABA) signaling.	The AtLRK10L1.2, Arabidopsis ortholog of wheat LRK10, is involved in ABA-mediated signaling and drought resistance.2015 · DOI: 10.1007/s00299-014-1724-2
`At1g25390`	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1.	No verified direct reference in this release
`At2g23450`	Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_007066 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0042631 cellular response to water deprivation Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0048573 photoperiodism, flowering Biological Process

GO:0071215 cellular response to abscisic acid stimulus Biological Process

GO:0071456 cellular response to hypoxia Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0030247 polysaccharide binding Molecular Function

GO:0106310 protein serine kinase activity Molecular Function

KEGG gene cross-reference

ath:AT1G18390

ath:AT1G66880

ath:AT5G38210

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.839

Rank 1 · LXL04_007066 · OH-1004

Endoplasmic reticulum0.087

Rank 2 · LXL04_007066 · OH-1004

Cytoplasm0.081

Rank 3 · LXL04_007066 · OH-1004

Nucleus0.054

Rank 4 · LXL04_007066 · OH-1004

Lysosome / Vacuole0.033

Rank 5 · LXL04_007066 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13947.12GUB_WAK_bind41-101 aa

PF14380.12WAK_assoc168-236 aa

PF13947.12GUB_WAK_bind353-416 aa

PF14380.12WAK_assoc470-563 aa

PF00069.32Pkinase685-957 aa

PF07714.24PK_Tyr_Ser-Thr688-959 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_007066	`PF13947.12`	GUB_WAK_bind	41	101	5.8e-30	104.2
LXL04_007066	`PF14380.12`	WAK_assoc	168	236	5e-31	108.1
LXL04_007066	`PF13947.12`	GUB_WAK_bind	353	416	5.8e-30	104.2
LXL04_007066	`PF14380.12`	WAK_assoc	470	563	5e-31	108.1
LXL04_007066	`PF00069.32`	Pkinase	685	957	1.4e-48	166.3
LXL04_007066	`PF07714.24`	PK_Tyr_Ser-Thr	688	959	6.9e-50	170.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8VYG0`	Arabidopsis thaliana	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.3	45.633%	Swiss-Prot	moderate database homology
`F4HQ17`	Arabidopsis thaliana	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.4	44.428%	Swiss-Prot	moderate database homology
`P0C5E2`	Arabidopsis thaliana	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.2	44.984%	Swiss-Prot	moderate database homology
`Q9C6K9`	Arabidopsis thaliana	LEAF RUST 10 DISEASE-RESISTANCE LOCUS RECEPTOR-LIKE PROTEIN KINASE-like 1.1	42.949%	Swiss-Prot	moderate database homology
`Q8RY67`	Arabidopsis thaliana	Wall-associated receptor kinase-like 14	48.667%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card