TkA03G072260 | RubberDandelionOmics

Gene overview

TkA03G072260

Reference: TK1151 Chr: Chr03 Coordinates: 18538886-18543313 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1314 bp · TkA03G072260|TK1151|cDNA

ATTTCCTACAATTTTATGATATTAATATCTGTCGATTTTTGTCACAGGTGGATTCGATACTGCACATGCAGCTGCACGGGCATACGATAGGGCAGCGATCAAGTTCCGGGGAATGGAAGCTGACATAAACTTCAGCCTTCAAGACTACGACGATGATCTGAAACAGATGAACAATCTGACGAAGGAAGAGTTTGTGCATGTACTAAGGAGACAAAGTACAGGATTTCCTAGAGGGAGTTCGAAATATAGAGGAGTTACTT...

CDS

Download CDS FASTA

1509 bp · TkA03G072260|TK1151|CDS

ATGTGGGATCTAAACGGGTCACCCGATCTGAGAAAGGATCACGAAGAATCAAACGGTTGTTTGACGCCGGTGGAAGCAGACGATGACGATAATAGTAAAGGTAAAGCGGTTGGATCCGTGTCAAACTCGAGCTCCTCCGTGGTGGTTATGGAGGAAGACGACGGCTCCGACGATGATGATTCCGAGAAAGGAGGGAGTTCAAGAAAACGAAGCAGTAGGTTGTTTGGCTTCTCCATCGACGGAGACGGCGATCCACCGGT...

Protein

Download Protein FASTA

502 aa · TkA03G072260|TK1151|PROTEIN

MWDLNGSPDLRKDHEESNGCLTPVEADDDDNSKGKAVGSVSNSSSSVVVMEEDDGSDDDDSEKGGSSRKRSSRLFGFSIDGDGDPPVTHQFFPVDGSEMGPTTSLAVGMPSVTSFPAAHWVGVQFCHQSPVPISGTTSATVAGGFLGKSAAPEIPQPLKKSRRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAHAAARAYDRAAIKFRGMEADINFSLQDYDDDLKQMNNLTKEEFVHVLRRQSTGFPRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G072260`
TK1151 ID	TkA03G072260
OH-1004 ID	LXL04_006797
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G072260

Location Chr03:18538886-18543313 (-)

Description Similar to AP2: Floral homeotic protein APETALA 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36920`	Probable transcriptional activator that promotes early floral meristem identity.	No verified direct reference in this release
`At5g67180`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: B8AVJ9`	Transcription factor.	No verified direct reference in this release
`Os04g0649100`	Transcription factor.	Genetic control of seed shattering in rice by the APETALA2 transcription factor shattering abortion1.2012 · DOI: 10.1105/tpc.111.094383
`Os07g0235800`	Probable transcription factor (By similarity).	OsMADS1 Represses microRNA172 in Elongation of Palea/Lemma Development in Rice.2016 · DOI: 10.3389/fpls.2016.01891
`UniProt: B8B8J2`	Probable transcription factor (By similarity).	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006797 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010093 specification of floral organ identity Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0030154 cell differentiation Biological Process

GO:0048316 seed development Biological Process

GO:0048460 flower formation Biological Process

KEGG gene cross-reference

ath:AT4G36920

ath:AT5G67180

osa:4334582

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · TkA03G072260 · TK1151

Cytoplasm0.069

Rank 2 · TkA03G072260 · TK1151

Cell membrane0.025

Rank 3 · TkA03G072260 · TK1151

Endoplasmic reticulum0.017

Rank 4 · TkA03G072260 · TK1151

Plastid0.014

Rank 5 · TkA03G072260 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847AP2171-220 aa

PF00847AP2262-312 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G072260	`PF00847`	AP2	171	220	9.9e-22	77.7
TkA03G072260	`PF00847`	AP2	262	312	9.9e-22	77.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P47927`	Arabidopsis thaliana	sp\|P47927\|AP2_ARATH Floral homeotic protein APETALA 2	59.100%	Swiss-Prot	High
`Q9FH95`	Arabidopsis thaliana	sp\|Q9FH95\|TOE3_ARATH AP2-like ethylene-responsive transcription factor TOE3	66.300%	Swiss-Prot	High
`B8AVJ9`	Oryza sativa subsp. indica	sp\|B8AVJ9\|APL25_ORYSI APETALA2-like protein 5	81.900%	Swiss-Prot	Low
`A0A0N7KJT8`	Oryza sativa subsp. japonica	sp\|A0A0N7KJT8\|APL25_ORYSJ APETALA2-like protein 5	82.200%	Swiss-Prot	Low
`Q8H443`	Oryza sativa subsp. japonica	sp\|Q8H443\|AP23_ORYSJ APETALA2-like protein 3	66.100%	Swiss-Prot	Medium
`B8B8J2`	Oryza sativa subsp. indica	sp\|B8B8J2\|AP23_ORYSI APETALA2-like protein 3	81.100%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card