LXL04_006797 | RubberDandelionOmics

Gene overview

LXL04_006797

Reference: OH-1004 Chr: Chr02 Coordinates: 25416974-25420896 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1509 bp · LXL04_006797|LXL04_006797|OH1004|cDNA

ATGTGGGATCTAAACGGGTCACCCGATCTGAGAAAGGATCACGAAGAATCAAACGGTTGTTTGACGCCGGTGGAAGCAGACGATGACGATAATAGTAAAGGTAAAGCGGTTGGATCCGTGTCAAACTCGAGCTCCTCCGTGGTGGTTATGGAGGAAGACGACGGCTCCGACGATGATGATTCCGAGAAAGGAGGGAGTTCAAGAAAACGAAGCAGTAGGTTGTTTGGCTTCTCCATCGACGGAGACGGCGATCCACCGGT...

CDS

Download CDS FASTA

1509 bp · LXL04_006797|LXL04_006797|OH1004|CDS

ATGTGGGATCTAAACGGGTCACCCGATCTGAGAAAGGATCACGAAGAATCAAACGGTTGTTTGACGCCGGTGGAAGCAGACGATGACGATAATAGTAAAGGTAAAGCGGTTGGATCCGTGTCAAACTCGAGCTCCTCCGTGGTGGTTATGGAGGAAGACGACGGCTCCGACGATGATGATTCCGAGAAAGGAGGGAGTTCAAGAAAACGAAGCAGTAGGTTGTTTGGCTTCTCCATCGACGGAGACGGCGATCCACCGGT...

Protein

Download Protein FASTA

502 aa · LXL04_006797|LXL04_006797|OH1004|PROTEIN

MWDLNGSPDLRKDHEESNGCLTPVEADDDDNSKGKAVGSVSNSSSSVVVMEEDDGSDDDDSEKGGSSRKRSSRLFGFSIDGDGDPPVTHQFFPVDGSEMGPTTSLAVGMPSVTSFPAAHWVGVQFCHQSPVPISGTTSATVAGGFLGKSAAPEIPQPLKKSRRGPRSRSSQYRGVTFYRRTGRWESHIWDCGKQVYLGGFDTAHAAARAYDRAAIKFRGMEADINFSLQDYDDDLKQMNNLTKEEFVHVLRRQSTGFPRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006797`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006797

Location Chr02:25416974-25420896 (-)

Description Similar to AP2: Floral homeotic protein APETALA 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g36920`	Probable transcriptional activator that promotes early floral meristem identity.	No verified direct reference in this release
`At5g67180`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0818800`	Probable transcription factor (By similarity).	Two AP2 family genes, supernumerary bract (SNB) and Osindeterminate spikelet 1 (OsIDS1), synergistically control inflorescence architecture and floral meristem establishment in rice.2012 · DOI: 10.1111/j.1365-313x.2011.04804.x OsMADS1 Represses microRNA172 in Elongation of Palea/Lemma Development in Rice.2016 · DOI: 10.3389/fpls.2016.01891
`UniProt: B8AMA9`	Probable transcription factor (By similarity).	No verified direct reference in this release
`Os04g0649100`	Transcription factor.	Genetic control of seed shattering in rice by the APETALA2 transcription factor shattering abortion1.2012 · DOI: 10.1105/tpc.111.094383

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006797 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009409 response to cold Biological Process

GO:0009873 ethylene-activated signaling pathway Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010093 specification of floral organ identity Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0030154 cell differentiation Biological Process

GO:0048316 seed development Biological Process

GO:0048460 flower formation Biological Process

KEGG gene cross-reference

ath:AT4G36920

ath:AT5G67180

osa:4334582

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.973

Rank 1 · LXL04_006797 · OH-1004

Cytoplasm0.069

Rank 2 · LXL04_006797 · OH-1004

Cell membrane0.025

Rank 3 · LXL04_006797 · OH-1004

Endoplasmic reticulum0.017

Rank 4 · LXL04_006797 · OH-1004

Plastid0.014

Rank 5 · LXL04_006797 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00847.27AP2171-220 aa

PF00847.27AP2262-312 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006797	`PF00847.27`	AP2	171	220	9.9e-22	77.7
LXL04_006797	`PF00847.27`	AP2	262	312	9.9e-22	77.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P47927`	Arabidopsis thaliana	Floral homeotic protein APETALA 2	55.020%	Swiss-Prot	strong database homology
`Q9FH95`	Arabidopsis thaliana	AP2-like ethylene-responsive transcription factor TOE3	56.704%	Swiss-Prot	strong database homology
`Q84TB5`	Oryza sativa subsp. japonica	APETALA2-like protein 2	73.733%	Swiss-Prot	weak database homology
`B8AMA9`	Oryza sativa subsp. indica	APETALA2-like protein 2	73.733%	Swiss-Prot	weak database homology
`A0A0N7KJT8`	Oryza sativa subsp. japonica	APETALA2-like protein 5	82.524%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card