TkA03G048520 | RubberDandelionOmics

Gene overview

TkA03G048520

Reference: TK1151 Chr: Chr03 Coordinates: 12781466-12786709 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1261 bp · TkA03G048520|TK1151|cDNA

CCAACCCCTTCGTTTTCTTTATGTGATTCACTTCTTGATTGTTTACCTTCTCCATGGAGGCGAAGCTACTCAAAGTCCCCTTTTCCCCTGCCATCTCCGCCACTTCTTTATCTAAATCCTGTAGACCAATTACTCCATTTCGTCCTCCAATGTGGAAAAACTGGAGCTTGCAGTTGCAGACACCCAATTTAGGGGTTTCGAAGAATGGCATTCAATCCGTTCAAGCATCCGCGACTTCATCTGGATCGAAAAACGAGACA...

CDS

Download CDS FASTA

960 bp · TkA03G048520|TK1151|CDS

ATGGAGGCGAAGCTACTCAAAGTCCCCTTTTCCCCTGCCATCTCCGCCACTTCTTTATCTAAATCCTGTAGACCAATTACTCCATTTCGTCCTCCAATGTGGAAAAACTGGAGCTTGCAGTTGCAGACACCCAATTTAGGGGTTTCGAAGAATGGCATTCAATCCGTTCAAGCATCCGCGACTTCATCTGGATCGAAAAACGAGACACGAATTGACGAAAGTGAGATCTATACTCTCGATGGTATAAGAAGCTCGTTAAT...

Protein

Download Protein FASTA

319 aa · TkA03G048520|TK1151|PROTEIN

MEAKLLKVPFSPAISATSLSKSCRPITPFRPPMWKNWSLQLQTPNLGVSKNGIQSVQASATSSGSKNETRIDESEIYTLDGIRSSLIRQEDSIIFSLVERAQFCYNEDTYDPNAFFMDGFQGSLVEFMVKETEKIYSQVGRYKSPDEHPFFPNDLPDPMLPPLQYPQVLHSCANGININHKIWDIYFKDLLPRLVKEGNDGNCGSAATCDSTCLQALSKRIHYGKFVAEAKFRASPSDYEAAIKSQDKKKLMDLLTYPEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G048520`
TK1151 ID	TkA03G048520
OH-1004 ID	LXL04_006567
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G048520

Location Chr03:12781466-12786709 (+)

Description Similar to CM1: Chorismate mutase 1, chloroplastic

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g29200`	May play a role in chloroplast biogenesis.	No verified direct reference in this release
`At1g69370`	May play a role in chloroplast biogenesis.	No verified direct reference in this release
`At5g10870`	Chorismate mutase 2.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006567 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000162 L-tryptophan biosynthetic process Biological Process

GO:0008652 amino acid biosynthetic process Biological Process

GO:0009073 aromatic amino acid family biosynthetic process Biological Process

GO:0010597 green leaf volatile biosynthetic process Biological Process

GO:0042742 defense response to bacterium Biological Process

GO:0046417 chorismate metabolic process Biological Process

GO:1901747 prephenate(2-) biosynthetic process Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

GO:0009570 chloroplast stroma Cellular Component

KEGG gene cross-reference

ath:AT1G69370

ath:AT3G29200

ath:AT5G10870

zma:100272431

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.957

Rank 1 · TkA03G048520 · TK1151

Mitochondrion0.069

Rank 2 · TkA03G048520 · TK1151

Cytoplasm0.026

Rank 3 · TkA03G048520 · TK1151

Nucleus0.021

Rank 4 · TkA03G048520 · TK1151

Cell membrane0.015

Rank 5 · TkA03G048520 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF25961OTOGL_N103-111 aa

PF01817CM_2135-149 aa

PF25961OTOGL_N199-220 aa

PF01817CM_2206-310 aa

PF28160DUF8374230-289 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G048520	`PF25961`	OTOGL_N	103	111	0.89	10.6
TkA03G048520	`PF01817`	CM_2	135	149	1e-11	45.6
TkA03G048520	`PF25961`	OTOGL_N	199	220	0.89	10.6
TkA03G048520	`PF01817`	CM_2	206	310	1e-11	45.6
TkA03G048520	`PF28160`	DUF8374	230	289	0.01	16.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P42738`	Arabidopsis thaliana	sp\|P42738\|CM1_ARATH Chorismate mutase 1, chloroplastic	65.300%	Swiss-Prot	High
`Q9C544`	Arabidopsis thaliana	sp\|Q9C544\|CM3_ARATH Chorismate mutase 3, chloroplastic	59.900%	Swiss-Prot	High
`Q9S7H4`	Arabidopsis thaliana	sp\|Q9S7H4\|CM2_ARATH Chorismate mutase 2	54.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card