TkA03G042580 | RubberDandelionOmics

Gene overview

TkA03G042580

Reference: TK1151 Chr: Chr03 Coordinates: 11203634-11208943 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

969 bp · TkA03G042580|TK1151|cDNA

ATGCAAGAAGTTATGAGCTGGTTACTGGAGCCTTTAAGCAGTAAATGGACACAGTTGGATTGGCAAAACACGTATCTGTCTGATCCATCAGGTCTGGTTAAATTATGTGGTGAAACTCAGTTCATGTGGTCATTATTCCACACTGTCACTTTCTTTGAAAAAGCACTTAAAAGAAGTGGAGTTAAAAAAGGGAATCTAAATTGGGCTTTCAACAGTTTGAAGAAACCAATTGTGTCAGAGAATTGGCTGCACCAGTGCTG...

CDS

Download CDS FASTA

969 bp · TkA03G042580|TK1151|CDS

ATGCAAGAAGTTATGAGCTGGTTACTGGAGCCTTTAAGCAGTAAATGGACACAGTTGGATTGGCAAAACACGTATCTGTCTGATCCATCAGGTCTGGTTAAATTATGTGGTGAAACTCAGTTCATGTGGTCATTATTCCACACTGTCACTTTCTTTGAAAAAGCACTTAAAAGAAGTGGAGTTAAAAAAGGGAATCTAAATTGGGCTTTCAACAGTTTGAAGAAACCAATTGTGTCAGAGAATTGGCTGCACCAGTGCTG...

Protein

Download Protein FASTA

322 aa · TkA03G042580|TK1151|PROTEIN

MQEVMSWLLEPLSSKWTQLDWQNTYLSDPSGLVKLCGETQFMWSLFHTVTFFEKALKRSGVKKGNLNWAFNSLKKPIVSENWLHQCWKEHRHVPHDSYRVPPFSGLIISGILPKKRARSYLFGNSAHIPGLDFPVQELFLEDVLEKTRYTVKLEDNNVHGSVYKSYNPNTRQSLEDWSGSKTDMGLVEATIEYICRHEGPGAILVFLTGWDKISKLLDNVKANNFLSNPSKFLVLPLHGSMPTINQREIFDRPPSGTRYN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G042580`
TK1151 ID	TkA03G042580
OH-1004 ID	LXL04_005268
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	75.700
Protein coverage (%)	TK1151 79.193 / OH-1004 58.258 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G042580

Location Chr03:11203634-11208943 (+)

Description Similar to At2g35920: DExH-box ATP-dependent RNA helicase DExH1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g35920`	DExH-box ATP-dependent RNA helicase DExH1.	No verified direct reference in this release
`At3g05040`	Nucleocytoplasmic transporter involved in the nuclear export of microRNAs (miRNAs).	HASTY, the Arabidopsis ortholog of exportin 5/MSN5, regulates phase change and morphogenesis.2003 · DOI: 10.1242/dev.00362 Nuclear processing and export of microRNAs in Arabidopsis.2005 · DOI: 10.1073/pnas.0405570102 Temporal regulation of shoot development in Arabidopsis thaliana by miR156 and its target SPL3.2006 · DOI: 10.1242/dev.02521
`At1g48650`	DExH-box ATP-dependent RNA helicase DExH3.	No verified direct reference in this release
`At2g01130`	DExH-box ATP-dependent RNA helicase DExH5, mitochondrial.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_005268 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009932 cell tip growth Biological Process

GO:0010053 root epidermal cell differentiation Biological Process

GO:0010215 cellulose microfibril organization Biological Process

GO:0048765 root hair cell differentiation Biological Process

GO:0048768 root hair cell tip growth Biological Process

GO:0052324 plant-type cell wall cellulose biosynthetic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0005768 endosome Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005802 trans-Golgi network Cellular Component

GO:0005829 cytosol Cellular Component

KEGG gene cross-reference

ath:AT1G48650

ath:AT2G01130

ath:AT2G35920

ath:AT4G16120

ath:AT5G49270

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.451

Rank 1 · TkA03G042580 · TK1151

Cytoplasm0.388

Rank 2 · TkA03G042580 · TK1151

Mitochondrion0.134

Rank 3 · TkA03G042580 · TK1151

Endoplasmic reticulum0.067

Rank 4 · TkA03G042580 · TK1151

Cell membrane0.056

Rank 5 · TkA03G042580 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF19273Exportin-52-75 aa

PF00271Helicase_C189-256 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G042580	`PF19273`	Exportin-5	2	75	4e-21	75.4
TkA03G042580	`PF00271`	Helicase_C	189	256	0.0092	16.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4ILR7`	Arabidopsis thaliana	sp\|F4ILR7\|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1	54.000%	Swiss-Prot	Low
`Q0WP44`	Arabidopsis thaliana	sp\|Q0WP44\|HASTY_ARATH Protein HASTY 1	72.700%	Swiss-Prot	Low
`F4HYJ7`	Arabidopsis thaliana	sp\|F4HYJ7\|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3	35.400%	Swiss-Prot	Low
`F4IM84`	Arabidopsis thaliana	sp\|F4IM84\|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial	34.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card