TkA03G032660 | RubberDandelionOmics

Gene overview

TkA03G032660

Reference: TK1151 Chr: Chr03 Coordinates: 8702546-8705393 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1548 bp · TkA03G032660|TK1151|cDNA

AAAAGGGCCTGTTCGAGAAGAGGAAGCAGGAGAGCTTCTAGGAATTGGGTGTTTCTCTGATTTGTCTCTTGATTTTCGGATGTTTGCCTCAAATGATCAAATGTGTAATACAAGTTTGAATGTTAAGTTTAGTGAATTTGATTATCTGGGTTGCGTGCGAATTGTTCCATTTCAAGCTAGTTGTGTCGTAATCTTCGATCGATACAGTAAAGTCTATTGACGTGGCAAGATTAAATTACTTCTCAAAGAACTCAAGAATG...

CDS

Download CDS FASTA

906 bp · TkA03G032660|TK1151|CDS

ATGGAACATGATGAAATAACAAGGTGGGAAGCTTTAGATATTGACATTCTGGTGAAGATATTTCAAAGGTTTGACATTTTTGAGTTGACTTCCGGTATCGGTCATATCTGCCGGACATGGCGTTTAGCTGCTTGTGACCCTTTATTGTGGAAGACTCTTGATTTGTCAATGTTGAGATCCAATTTCATAAAAATCCCGCTCGAGCCTTACGTGTATGTGGATGGAAGATCTGATAAACAACTCACGAAACTTCTGAAGAT...

Protein

Download Protein FASTA

301 aa · TkA03G032660|TK1151|PROTEIN

MEHDEITRWEALDIDILVKIFQRFDIFELTSGIGHICRTWRLAACDPLLWKTLDLSMLRSNFIKIPLEPYVYVDGRSDKQLTKLLKIALSLSHGSITTLIFHFNLYVSDDQLTYTAERTPELKRLVLPAWNRIKKTGICKAISMWNNLESLTMPSIANPPYFMEEISKHCKKFSELKIMGPCDILCIQTLIRCVPNLKVLSLRVSIVYKDALLLILNGLKNLQVLNISHSLIIDAPATRTLVTELDDIILQKASRLKQFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G032660`
TK1151 ID	TkA03G032660
OH-1004 ID	LXL04_011884
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.000
Protein coverage (%)	TK1151 100.000 / OH-1004 90.937 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G032660

Location Chr03:8702546-8705393 (+)

Description Similar to At3g48880: F-box/LRR-repeat protein At3g48880

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48880`	F-box/LRR-repeat protein At3g48880.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011884 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010608 post-transcriptional regulation of gene expression Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0050829 defense response to Gram-negative bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

GO:1905761 SCF ubiquitin ligase complex binding Molecular Function

KEGG gene cross-reference

ath:AT3G48880

ath:AT4G05497

ath:AT4G08980

ath:AT4G11580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.515

Rank 1 · TkA03G032660 · TK1151

Cytoplasm0.290

Rank 2 · TkA03G032660 · TK1151

Cell membrane0.084

Rank 3 · TkA03G032660 · TK1151

Plastid0.078

Rank 4 · TkA03G032660 · TK1151

Endoplasmic reticulum0.056

Rank 5 · TkA03G032660 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00646F-box9-51 aa

PF12937F-box-like15-55 aa

PF12799LRR_460-67 aa

PF24758LRR_At5g5637091-181 aa

PF29594LRR_SKP2104-240 aa

PF12799LRR_4121-153 aa

PF24758LRR_At5g56370193-261 aa

PF12799LRR_4194-202 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G032660	`PF00646`	F-box	9	51	0.057	14.1
TkA03G032660	`PF12937`	F-box-like	15	55	2.7e-07	31.0
TkA03G032660	`PF12799`	LRR_4	60	67	0.26	12.3
TkA03G032660	`PF24758`	LRR_At5g56370	91	181	0.0047	17.3
TkA03G032660	`PF29594`	LRR_SKP2	104	240	0.032	14.2
TkA03G032660	`PF12799`	LRR_4	121	153	0.26	12.3
TkA03G032660	`PF24758`	LRR_At5g56370	193	261	0.0047	17.3
TkA03G032660	`PF12799`	LRR_4	194	202	0.26	12.3
TkA03G032660	`PF12799`	LRR_4	195	232	0.26	12.3
TkA03G032660	`PF00646`	F-box	210	228	0.057	14.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2Z5`	Arabidopsis thaliana	sp\|Q9M2Z5\|FBL53_ARATH F-box/LRR-repeat protein At3g48880	63.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card