LXL04_011884 | RubberDandelionOmics

Gene overview

LXL04_011884

Reference: OH-1004 Chr: Chr03 Coordinates: 2175279-2178012 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

996 bp · LXL04_011884|LXL04_011884|OH1004|cDNA

ATGAAAAGGGCCTGTTCGAGAAGAGGAAGCAGGAGAGCTTCTAGGTCTATTGACGTGGCAAGATTAAATTACTTCTCAAAGAACTCAAGAATGGAACATGATGAAACAACAAGGTGGGAAGATTTAGATATTGACATTCTGGTGAAGATATTTCAAAGGTTTGACGTTTTTGAGTTGACTTCCGGTATCGGTCATATCTGCCGGACATGGCGTTTAGCTGCTTGTGACCCTTTATTGTGGAAGACTCTTGATTTGTCAAT...

CDS

Download CDS FASTA

996 bp · LXL04_011884|LXL04_011884|OH1004|CDS

ATGAAAAGGGCCTGTTCGAGAAGAGGAAGCAGGAGAGCTTCTAGGTCTATTGACGTGGCAAGATTAAATTACTTCTCAAAGAACTCAAGAATGGAACATGATGAAACAACAAGGTGGGAAGATTTAGATATTGACATTCTGGTGAAGATATTTCAAAGGTTTGACGTTTTTGAGTTGACTTCCGGTATCGGTCATATCTGCCGGACATGGCGTTTAGCTGCTTGTGACCCTTTATTGTGGAAGACTCTTGATTTGTCAAT...

Protein

Download Protein FASTA

331 aa · LXL04_011884|LXL04_011884|OH1004|PROTEIN

MKRACSRRGSRRASRSIDVARLNYFSKNSRMEHDETTRWEDLDIDILVKIFQRFDVFELTSGIGHICRTWRLAACDPLLWKTLDLSMLRSNFIKIPLEPYVYVDGRSDKQLTKLLKIALSLSHGSITTLIFHFNLYVSDDQLTYTAERTPELKRLVLPAWNRIKKTGICKAISMWNNLESLTMPSIANPPYFMEEISKHCKKFSELKIMGPCDILCIQTLIRCVPNLKVLSLRVSIVYKDALLLILNGLKNLQVLNISHS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011884`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011884

Location Chr03:2175279-2178012 (-)

Description Similar to At3g48880: F-box/LRR-repeat protein At3g48880

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g48880`	F-box/LRR-repeat protein At3g48880.	No verified direct reference in this release
`At4g11580`	Putative F-box protein At4g11580.	No verified direct reference in this release
`At4g05500`	Putative F-box/LRR-repeat protein 23.	No verified direct reference in this release
`At4g08980`	Component of SCF(ASK-cullin-F-box) E3 ubiquitin ligase complexes, which may mediate the ubiquitination and subsequent proteasomal degradation of target proteins.	No verified direct reference in this release
`At4g05497`	Putative F-box/LRR-repeat protein 9.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011884 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006511 ubiquitin-dependent protein catabolic process Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010608 post-transcriptional regulation of gene expression Biological Process

GO:0010629 negative regulation of gene expression Biological Process

GO:0016567 protein ubiquitination Biological Process

GO:0031146 SCF-dependent proteasomal ubiquitin-dependent protein catabolic process Biological Process

GO:0050829 defense response to Gram-negative bacterium Biological Process

GO:0005634 nucleus Cellular Component

GO:0019005 SCF ubiquitin ligase complex Cellular Component

GO:1905761 SCF ubiquitin ligase complex binding Molecular Function

KEGG gene cross-reference

ath:AT3G48880

ath:AT4G05497

ath:AT4G08980

ath:AT4G11580

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.654

Rank 1 · LXL04_011884 · OH-1004

Cytoplasm0.209

Rank 2 · LXL04_011884 · OH-1004

Plastid0.072

Rank 3 · LXL04_011884 · OH-1004

Cell membrane0.062

Rank 4 · LXL04_011884 · OH-1004

Mitochondrion0.037

Rank 5 · LXL04_011884 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12937.13F-box-like45-85 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011884	`PF12937.13`	F-box-like	45	85	2.5e-07	31.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M2Z5`	Arabidopsis thaliana	F-box/LRR-repeat protein At3g48880	65.203%	Swiss-Prot	strong database homology
`Q9T0C6`	Arabidopsis thaliana	Putative F-box protein At4g11580	28.024%	Swiss-Prot	weak database homology
`Q9S9V9`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein 23	21.457%	Swiss-Prot	weak database homology
`Q9ZPE4`	Arabidopsis thaliana	F-box protein FBW2	22.917%	Swiss-Prot	weak database homology
`Q9S9V8`	Arabidopsis thaliana	Putative F-box/LRR-repeat protein 9	22.176%	Swiss-Prot	weak database homology

JBrowse

View in Genome Browser

Gene Card