TkA03G029110 | RubberDandelionOmics

Gene overview

TkA03G029110

Reference: TK1151 Chr: Chr03 Coordinates: 7800333-7802102 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1770 bp · TkA03G029110|TK1151|cDNA

ATGGATTGCGACAATTCCGACAAAACGGGGCCGTCTTCTTCATTTCTCTACACCTGCAATGGCGTCCAATCTTGTTCAAGTTTCCTAATTTTCAGAACTCAACCTCTTTACAACACAGTTCTCACCATCTCCAAGCTCATGTCAACCGAAGCCAAAGTTCTAGCCCAAATCAACGGCATCACTGATTCCGCCCAAATTTTACCTCTAAACAGAGAGCTAATCATTCCGGTAACGTGTTCTTGTTCCGGTGATCAATACTA...

CDS

Download CDS FASTA

1770 bp · TkA03G029110|TK1151|CDS

ATGGATTGCGACAATTCCGACAAAACGGGGCCGTCTTCTTCATTTCTCTACACCTGCAATGGCGTCCAATCTTGTTCAAGTTTCCTAATTTTCAGAACTCAACCTCTTTACAACACAGTTCTCACCATCTCCAAGCTCATGTCAACCGAAGCCAAAGTTCTAGCCCAAATCAACGGCATCACTGATTCCGCCCAAATTTTACCTCTAAACAGAGAGCTAATCATTCCGGTAACGTGTTCTTGTTCCGGTGATCAATACTA...

Protein

Download Protein FASTA

589 aa · TkA03G029110|TK1151|PROTEIN

MDCDNSDKTGPSSSFLYTCNGVQSCSSFLIFRTQPLYNTVLTISKLMSTEAKVLAQINGITDSAQILPLNRELIIPVTCSCSGDQYYQANTSFVIPTLYDTYFTIANYTYEGLTTCDSLDKYNDYDRLDLHAGEKLHVPLRCACPTASQTDDGITFLLTYLITWEDTIERISNRFNVSLQDLVLGNGFSSVDDLMFPFTTFLIPLSTEPSSSQTRTLDRNRNRNPLKKGIIAGTISGGFLAIVCGVFVIWLVSKSKRREC...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G029110`
TK1151 ID	TkA03G029110
OH-1004 ID	LXL04_006388
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 97.841 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G029110

Location Chr03:7800333-7802102 (-)

Description Similar to LYK4: LysM domain receptor-like kinase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23770`	Lysin motif (LysM) receptor kinase that functions as a cell surface receptor in chitin elicitor (chitooligosaccharides) signaling leading to innate immunity.	LYK4, a lysin motif receptor-like kinase, is important for chitin signaling and plant innate immunity in Arabidopsis.2012 · DOI: 10.1104/pp.112.201699
`At2g33580`	May recognize microbe-derived N-acetylglucosamine (NAG)-containing ligands.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os08g0538300`	Lysin motif (LysM) receptor kinase required as a cell surface receptor for chitin elicitor (chitooligosaccharides) signaling leading to innate immunity in response to biotic stresses.	Two LysM receptor molecules, CEBiP and OsCERK1, cooperatively regulate chitin elicitor signaling in rice.2010 · DOI: 10.1111/j.1365-313x.2010.04324.x Functional characterization of CEBiP and CERK1 homologs in arabidopsis and rice reveals the presence of different chitin receptor systems in plants.2012 · DOI: 10.1093/pcp/pcs113 A receptor-like cytoplasmic kinase targeted by a plant pathogen effector is directly phosphorylated by the chitin receptor and mediates rice immunity.2013 · DOI: 10.1016/j.chom.2013.02.007 Targeted gene disruption of OsCERK1 reveals its indispensable role in chitin perception and involvement in the peptidoglycan response and immunity in rice.2014 · DOI: 10.1094/mpmi-03-14-0068-r OsCERK1 and OsRLCK176 play important roles in peptidoglycan and chitin signaling in rice innate immunity.2014 · DOI: 10.1111/tpj.12710

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006388 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006952 defense response Biological Process

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009877 nodulation Biological Process

GO:0010200 response to chitin Biological Process

GO:0045087 innate immune response Biological Process

GO:0071219 cellular response to molecule of bacterial origin Biological Process

GO:0071323 cellular response to chitin Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:1902290 positive regulation of defense response to oomycetes Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005775 vacuolar lumen Cellular Component

KEGG gene cross-reference

ath:AT2G23770

ath:AT2G33580

dosa:Os09g0511000

mtr:11410973

osa:9270778

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.756

Rank 1 · TkA03G029110 · TK1151

Endoplasmic reticulum0.113

Rank 2 · TkA03G029110 · TK1151

Cytoplasm0.082

Rank 3 · TkA03G029110 · TK1151

Lysosome / Vacuole0.075

Rank 4 · TkA03G029110 · TK1151

Nucleus0.052

Rank 5 · TkA03G029110 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23446LysM1_NFP_LYK24-81 aa

PF23473LysM3_LYK4_539-68 aa

PF01476LysM42-76 aa

PF23472LysM2_CERK1_LYK3_4_586-141 aa

PF23457LysM2_NFP86-140 aa

PF03689Nepo_coat_N92-129 aa

PF01476LysM100-139 aa

PF23446LysM1_NFP_LYK122-144 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G029110	`PF23446`	LysM1_NFP_LYK	24	81	1.1e-21	78.2
TkA03G029110	`PF23473`	LysM3_LYK4_5	39	68	3e-16	60.0
TkA03G029110	`PF01476`	LysM	42	76	3.5e-07	30.8
TkA03G029110	`PF23472`	LysM2_CERK1_LYK3_4_5	86	141	1.2e-23	83.4
TkA03G029110	`PF23457`	LysM2_NFP	86	140	0.024	15.4
TkA03G029110	`PF03689`	Nepo_coat_N	92	129	0.21	12.3
TkA03G029110	`PF01476`	LysM	100	139	3.5e-07	30.8
TkA03G029110	`PF23446`	LysM1_NFP_LYK	122	144	1.1e-21	78.2
TkA03G029110	`PF23473`	LysM3_LYK4_5	156	205	3e-16	60.0
TkA03G029110	`PF23462`	LysM3_NFP	156	187	0.015	16.5
TkA03G029110	`PF01476`	LysM	165	197	3.5e-07	30.8
TkA03G029110	`PF23446`	LysM1_NFP_LYK	167	205	1.1e-21	78.2
TkA03G029110	`PF03109`	ABC1	308	324	0.35	10.7
TkA03G029110	`PF07714`	PK_Tyr_Ser-Thr	310	503	8.7e-40	137.4
TkA03G029110	`PF00069`	Pkinase	324	571	7.3e-38	131.2
TkA03G029110	`PF01476`	LysM	333	343	3.5e-07	30.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64825`	Arabidopsis thaliana	sp\|O64825\|LYK4_ARATH LysM domain receptor-like kinase 4	36.900%	Swiss-Prot	Medium
`O22808`	Arabidopsis thaliana	sp\|O22808\|LYK5_ARATH Protein LYK5	34.100%	Swiss-Prot	Medium
`A0A0P0XII1`	Oryza sativa subsp. japonica	sp\|A0A0P0XII1\|CERK1_ORYSJ Chitin elicitor receptor kinase 1	30.300%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card