LXL04_006388 | RubberDandelionOmics

Gene overview

LXL04_006388

Reference: OH-1004 Chr: Chr02 Coordinates: 9524010-9525991 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1809 bp · LXL04_006388|LXL04_006388|OH1004|cDNA

ATGTATTCCGGAAACACAGTCATGGATTGCGACAATTCCGACAAAACGGGGCCGTCTTCTTCATTTCTCTACACCTGCAATGGCGTCCAATCTTGTTCAAGTTTCCTAATTTTCAGAACTCAACCTCTTTACAACACAGTTCTCACCATCTCCAAGCTCATGTCAACCGAAGCCAAAGTTCTAGCCCAAATCAACGGCATCACTGATTCCGCCCAAATTTTACCTCTAAACAGAGAGCTAATCATTCCGGTAACGTGTTC...

CDS

Download CDS FASTA

1809 bp · LXL04_006388|LXL04_006388|OH1004|CDS

ATGTATTCCGGAAACACAGTCATGGATTGCGACAATTCCGACAAAACGGGGCCGTCTTCTTCATTTCTCTACACCTGCAATGGCGTCCAATCTTGTTCAAGTTTCCTAATTTTCAGAACTCAACCTCTTTACAACACAGTTCTCACCATCTCCAAGCTCATGTCAACCGAAGCCAAAGTTCTAGCCCAAATCAACGGCATCACTGATTCCGCCCAAATTTTACCTCTAAACAGAGAGCTAATCATTCCGGTAACGTGTTC...

Protein

Download Protein FASTA

602 aa · LXL04_006388|LXL04_006388|OH1004|PROTEIN

MYSGNTVMDCDNSDKTGPSSSFLYTCNGVQSCSSFLIFRTQPLYNTVLTISKLMSTEAKVLAQINGITDSAQILPLNRELIIPVTCSCSGDQYYQANTSFVIPTLYDTYFTIANYTYEGLTTCDSLDKYNDYDRLDLHAGEKLHVPLRCACPTASQTDDGITFLLTYLITWEDTIERISNRFNVSLQDLVLGNGFSSVDDLMFPFTTFLIPLSTEPSSSQTRTLDRNRNRNPLKKGIIAGTISGGFLAIVCGVFVIWLVS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006388`
TK1151 ID	TkA03G029110
OH-1004 ID	LXL04_006388
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.800
Protein coverage (%)	TK1151 100.000 / OH-1004 97.841 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006388

Location Chr02:9524010-9525991 (+)

Description Similar to LYK4: LysM domain receptor-like kinase 4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g23770`	Lysin motif (LysM) receptor kinase that functions as a cell surface receptor in chitin elicitor (chitooligosaccharides) signaling leading to innate immunity.	LYK4, a lysin motif receptor-like kinase, is important for chitin signaling and plant innate immunity in Arabidopsis.2012 · DOI: 10.1104/pp.112.201699
`At2g33580`	May recognize microbe-derived N-acetylglucosamine (NAG)-containing ligands.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0511000`	LysM domain receptor-like kinase 10.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006388 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0002237 response to molecule of bacterial origin Biological Process

GO:0006952 defense response Biological Process

GO:0009101 glycoprotein biosynthetic process Biological Process

GO:0009877 nodulation Biological Process

GO:0010200 response to chitin Biological Process

GO:0045087 innate immune response Biological Process

GO:0071219 cellular response to molecule of bacterial origin Biological Process

GO:0071323 cellular response to chitin Biological Process

GO:1900150 regulation of defense response to fungus Biological Process

GO:1902290 positive regulation of defense response to oomycetes Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005775 vacuolar lumen Cellular Component

KEGG gene cross-reference

ath:AT2G23770

ath:AT2G33580

dosa:Os09g0511000

mtr:11410973

osa:9270778

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.763

Rank 1 · LXL04_006388 · OH-1004

Endoplasmic reticulum0.109

Rank 2 · LXL04_006388 · OH-1004

Cytoplasm0.083

Rank 3 · LXL04_006388 · OH-1004

Lysosome / Vacuole0.071

Rank 4 · LXL04_006388 · OH-1004

Nucleus0.054

Rank 5 · LXL04_006388 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF23446.2LysM1_NFP_LYK31-88 aa

PF23472.2LysM2_CERK1_LYK3_4_593-148 aa

PF23473.2LysM3_LYK4_5163-212 aa

PF07714.24PK_Tyr_Ser-Thr317-510 aa

PF00069.32Pkinase331-578 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006388	`PF23446.2`	LysM1_NFP_LYK	31	88	1.2e-21	78.1
LXL04_006388	`PF23472.2`	LysM2_CERK1_LYK3_4_5	93	148	1.3e-23	83.4
LXL04_006388	`PF23473.2`	LysM3_LYK4_5	163	212	3.1e-16	59.9
LXL04_006388	`PF07714.24`	PK_Tyr_Ser-Thr	317	510	9.2e-40	137.3
LXL04_006388	`PF00069.32`	Pkinase	331	578	7.7e-38	131.1

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O64825`	Arabidopsis thaliana	LysM domain receptor-like kinase 4	36.672%	Swiss-Prot	moderate database homology
`O22808`	Arabidopsis thaliana	Protein LYK5	36.991%	Swiss-Prot	moderate database homology
`D7UPN3`	Oryza sativa subsp. japonica	LysM domain receptor-like kinase 10	32.169%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card