TkA03G025800 | RubberDandelionOmics

Gene overview

TkA03G025800

Reference: TK1151 Chr: Chr03 Coordinates: 6672264-6672659 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

396 bp · TkA03G025800|TK1151|cDNA

ATGGCCGATTTTGCAAAGGAAAGAGATTGGGATCAGTTTCACAGTCCCCGAAATCTTCTCCTCGCACTGGTAGGAGAAGTGGGAGAGTTATCTGAGATATTTCAATGGAAAGGAGAGGTACCAAAGGGACTTCCTGATTGGAAAAAAGAAGAAAAAGAACATCTTGGAGAGGAATTATCAGATGTTTTGTTATATTTAGTGAGGCTATCCGACATTTGTGGAATTGATCTTGGAAAAGCGGCTCTTAGAAAACTACAAGT...

CDS

Download CDS FASTA

396 bp · TkA03G025800|TK1151|CDS

ATGGCCGATTTTGCAAAGGAAAGAGATTGGGATCAGTTTCACAGTCCCCGAAATCTTCTCCTCGCACTGGTAGGAGAAGTGGGAGAGTTATCTGAGATATTTCAATGGAAAGGAGAGGTACCAAAGGGACTTCCTGATTGGAAAAAAGAAGAAAAAGAACATCTTGGAGAGGAATTATCAGATGTTTTGTTATATTTAGTGAGGCTATCCGACATTTGTGGAATTGATCTTGGAAAAGCGGCTCTTAGAAAACTACAAGT...

Protein

Download Protein FASTA

131 aa · TkA03G025800|TK1151|PROTEIN

MADFAKERDWDQFHSPRNLLLALVGEVGELSEIFQWKGEVPKGLPDWKKEEKEHLGEELSDVLLYLVRLSDICGIDLGKAALRKLQVNANKYPVNLSKGSSKKHNQIINNLPPPSTTNDNGNGSGSVDDGV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G025800`
TK1151 ID	TkA03G025800
OH-1004 ID	LXL04_014506
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 77.976 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA03G025800`
Location	Chr03:6672264-6672659 (-)
Description	Similar to Dctpp1: dCTP pyrophosphatase 1
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_014506` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006253 dCTP catabolic process Biological Process GO:0009143 nucleoside triphosphate catabolic process Biological Process GO:0042262 DNA protection Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0000287 magnesium ion binding Molecular Function GO:0016462 pyrophosphatase activity Molecular Function GO:0032556 pyrimidine deoxyribonucleotide binding Molecular Function GO:0042802 identical protein binding Molecular Function
KEGG gene cross-reference	bta:614103 hsa:79077 mmu:66422 rno:192252 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.698

Rank 1 · TkA03G025800 · TK1151

Nucleus0.414

Rank 2 · TkA03G025800 · TK1151

Plastid0.073

Rank 3 · TkA03G025800 · TK1151

Mitochondrion0.070

Rank 4 · TkA03G025800 · TK1151

Peroxisome0.056

Rank 5 · TkA03G025800 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03819MazG15-84 aa

PF12643MazG-like26-105 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G025800	`PF03819`	MazG	15	84	1.4e-06	29.2
TkA03G025800	`PF12643`	MazG-like	26	105	1.1e-08	35.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card