Gene Card
Gene overview
cDNA / CDS / Protein Sequences
507 bp · LXL04_014506|LXL04_014506|OH1004|cDNA
ATGTCAATGGGCGGCGGAACAGAAAAATCATTCGCGTCAACGGCGGCCGGAGATATGACTACTCcgaaagaaagagaagaagatgTAAGCTTGGCTGAGTTAAAGAAGAAAATGGCCGATTTTGCAAAGGAAAGAGATTGGGATCAGTTTCACAGTCCCCGAAATCTTCTCCTCGCACTGGTAGGAGAAGTGGGAGAGTTATCTGAGATATTTCAATGGAAAGGAGAGGTACCAAAGGGACTTCCTGATTggaaaaaaga...
507 bp · LXL04_014506|LXL04_014506|OH1004|CDS
ATGTCAATGGGCGGCGGAACAGAAAAATCATTCGCGTCAACGGCGGCCGGAGATATGACTACTCCGAAAGAAAGAGAAGAAGATGTAAGCTTGGCTGAGTTAAAGAAGAAAATGGCCGATTTTGCAAAGGAAAGAGATTGGGATCAGTTTCACAGTCCCCGAAATCTTCTCCTCGCACTGGTAGGAGAAGTGGGAGAGTTATCTGAGATATTTCAATGGAAAGGAGAGGTACCAAAGGGACTTCCTGATTGGAAAAAAGA...
Protein
Download Protein FASTA168 aa · LXL04_014506|LXL04_014506|OH1004|PROTEIN
MSMGGGTEKSFASTAAGDMTTPKEREEDVSLAELKKKMADFAKERDWDQFHSPRNLLLALVGEVGELSEIFQWKGEVPKGLPDWKKEEKEHLGEELSDVLLYLVRLSDICGIDLGKAALRKLQVNANKYPVNLSKGSSKKHNQIINNLPPPSTTNDNGNGSGSVDDGV
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_014506 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_014506 |
|---|---|
| Location | Chr03:51234817-51236221 (+) |
| Description | Similar to Dctpp1: dCTP pyrophosphatase 1 |
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene ArabidopsisNo hit for this species in the current source table. RiceNo hit for this species in the current source table. |
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · |
| GO annotations (OH1004 source) | GO:0006253 dCTP catabolic process Biological Process GO:0009143 nucleoside triphosphate catabolic process Biological Process GO:0042262 DNA protection Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005829 cytosol Cellular Component GO:0000166 nucleotide binding Molecular Function GO:0000287 magnesium ion binding Molecular Function GO:0016462 pyrophosphatase activity Molecular Function GO:0032556 pyrimidine deoxyribonucleotide binding Molecular Function GO:0042802 identical protein binding Molecular Function |
| KEGG gene cross-reference | bta:614103 hsa:79077 mmu:66422 rno:192252 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF03819.23MazG52-120 aaPF12643.13MazG-like63-142 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_014506 | PF03819.23 | MazG | 52 | 120 | 2.1e-06 | 28.6 |
| LXL04_014506 | PF12643.13 | MazG-like | 63 | 142 | 1.6e-08 | 35.4 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.
No result was found for this query.