TkA03G019120 | RubberDandelionOmics

Gene overview

TkA03G019120

Reference: TK1151 Chr: Chr03 Coordinates: 4981272-4982324 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

860 bp · TkA03G019120|TK1151|cDNA

TACAATTTCTTTTCCTTTCTTTTCCTTTCTTTTCTCTTATTTTCTTTCGTTTAATGAAACTTGGGAAATGGGCGTAAAGCTCTGCACACATAAAGAAACTGAAAATTTCTTCTTCCGTCAAGATGCCGACGATTAGCGATGATATCACCAAAGCTGAAAAGAAGAGCAAGAACAGAGACCACAAGCGAAAGCTCGAAGACCCAGAGCCTGAACTCGTTTCAGAATCCAAAAAGGACAAGAAAAAGAAGAAGAAGAAAGAA...

CDS

Download CDS FASTA

738 bp · TkA03G019120|TK1151|CDS

ATGCCGACGATTAGCGATGATATCACCAAAGCTGAAAAGAAGAGCAAGAACAGAGACCACAAGCGAAAGCTCGAAGACCCAGAGCCTGAACTCGTTTCAGAATCCAAAAAGGACAAGAAAAAGAAGAAGAAGAAAGAAAAGGGCGATAAGGTCGAAACCCCCCAAGTATTTGCAAACGGAAACGAAACCCTTAATAACTCAGACGAGTTGAGCGAGAAGAAGAAGAAGAAGAAAAAAAAGAAACAAAAGAACGAGGAAGA...

Protein

Download Protein FASTA

245 aa · TkA03G019120|TK1151|PROTEIN

MPTISDDITKAEKKSKNRDHKRKLEDPEPELVSESKKDKKKKKKKEKGDKVETPQVFANGNETLNNSDELSEKKKKKKKKKQKNEEEEIKNSDVNAVEEVRETEDNVVVSGKDINDSKYKALNSFSESNLSEQLLECCKNFSKPSPIQSNSWPFLLHGRDFIGIAKTGSGKTLAFGIPAMNHILNKRKKNPTNKRTPLCLVLSRFHPQGNLPNRFLTCYLKLENPVEFAQFVYMEEPLKDPKFLP

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G019120`
TK1151 ID	TkA03G019120
OH-1004 ID	LXL04_018950
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	46.300
Protein coverage (%)	TK1151 31.837 / OH-1004 10.215 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G019120

Location Chr03:4981272-4982324 (+)

Description Similar to RH24: DEAD-box ATP-dependent RNA helicase 24

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g31970`	ATP-dependent RNA helicase required for 60S ribosomal subunit synthesis.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0301200`	ATP-dependent RNA helicase required for 60S ribosomal subunit synthesis.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_018950 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0008104 intracellular protein localization Biological Process

GO:1903241 U2-type prespliceosome assembly Biological Process

GO:0005634 nucleus Cellular Component

GO:0005654 nucleoplasm Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0015030 Cajal body Cellular Component

GO:0016020 membrane Cellular Component

GO:0016604 nuclear body Cellular Component

GO:0016607 nuclear speck Cellular Component

GO:0071004 U2-type prespliceosome Cellular Component

KEGG gene cross-reference

ath:AT2G47330

dosa:Os03g0308500

hsa:11325

mmu:72047

xla:380261

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.944

Rank 1 · TkA03G019120 · TK1151

Cytoplasm0.116

Rank 2 · TkA03G019120 · TK1151

Cell membrane0.021

Rank 3 · TkA03G019120 · TK1151

Mitochondrion0.018

Rank 4 · TkA03G019120 · TK1151

Endoplasmic reticulum0.014

Rank 5 · TkA03G019120 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06459RR_TM4-613-94 aa

PF31026LST2_mid16-149 aa

PF15746TMEM21539-101 aa

PF00270DEAD75-75 aa

PF00270DEAD145-200 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G019120	`PF06459`	RR_TM4-6	13	94	8.7	6.7
TkA03G019120	`PF31026`	LST2_mid	16	149	2.1	7.6
TkA03G019120	`PF15746`	TMEM215	39	101	2.4	8.3
TkA03G019120	`PF00270`	DEAD	75	75	1.8e-11	44.8
TkA03G019120	`PF00270`	DEAD	145	200	1.8e-11	44.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9C551`	Arabidopsis thaliana	sp\|Q9C551\|RH5_ARATH DEAD-box ATP-dependent RNA helicase 5	65.700%	Swiss-Prot	Low
`Q6YS30`	Oryza sativa subsp. japonica	sp\|Q6YS30\|RH5_ORYSJ DEAD-box ATP-dependent RNA helicase 5	54.600%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card