Gene Card
Gene overview
cDNA / CDS / Protein Sequences
2235 bp · LXL04_018950|LXL04_018950|OH1004|cDNA
ATGTCCAAGAGAAAGTTTGGGTTCGAAGGCTTCGGTATTAACAAGCAATCGACGTATAGCTTCGAGCGACCTGAGGCCCCCCAGAGGCTCTACGTTCCTCCCTCATCTCGTGGCGGTGGACATGATCACTATGAAGACACCGACCTCGACAATATTGAGTATGAAGATCCCAGCCACAACCCGGCCAATAACGACGAAGGAGCCGGCGCAGCAGATGATGATGAAATCGACCCGCTTGACGCCTTTATGGAAGGGATTCA...
2235 bp · LXL04_018950|LXL04_018950|OH1004|CDS
ATGTCCAAGAGAAAGTTTGGGTTCGAAGGCTTCGGTATTAACAAGCAATCGACGTATAGCTTCGAGCGACCTGAGGCCCCCCAGAGGCTCTACGTTCCTCCCTCATCTCGTGGCGGTGGACATGATCACTATGAAGACACCGACCTCGACAATATTGAGTATGAAGATCCCAGCCACAACCCGGCCAATAACGACGAAGGAGCCGGCGCAGCAGATGATGATGAAATCGACCCGCTTGACGCCTTTATGGAAGGGATTCA...
Protein
Download Protein FASTA744 aa · LXL04_018950|LXL04_018950|OH1004|PROTEIN
MSKRKFGFEGFGINKQSTYSFERPEAPQRLYVPPSSRGGGHDHYEDTDLDNIEYEDPSHNPANNDEGAGAADDDEIDPLDAFMEGIHEEMKAAPPPKAKEKADKYRDDEEDDPMESFLRAKKDVGLTLASDALHAGYNSDEEVYAAAKAVDAGLLDYDSDDNPIVLDKKKIEPIAALDHSSIDYEPFNKDFYEEKPSISGMSEQDVGEYQKSLAIRVSGFDVPRPLKTFSEAGFSTELMKAIARQGYEKPTPIQCQSLPI...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | LXL04_018950 |
|---|---|
| Source version | OH-1004 / GCA_047496595.1_OSU_TarKok_2.0 |
SNP / Indel variants and carrier samplesCRA009020 · OH-1004
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | LXL04_018950 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr04:20336531-20339417 (-) | ||||||||||||
| Description | Similar to RH24: DEAD-box ATP-dependent RNA helicase 24 | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006397 mRNA processing Biological Process GO:0008104 intracellular protein localization Biological Process GO:1903241 U2-type prespliceosome assembly Biological Process GO:0005634 nucleus Cellular Component GO:0005654 nucleoplasm Cellular Component GO:0005737 cytoplasm Cellular Component GO:0005829 cytosol Cellular Component GO:0015030 Cajal body Cellular Component GO:0016020 membrane Cellular Component GO:0016604 nuclear body Cellular Component GO:0016607 nuclear speck Cellular Component GO:0071004 U2-type prespliceosome Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT2G47330 dosa:Os03g0308500 hsa:11325 mmu:72047 xla:380261 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF00270.36DEAD251-421 aaPF00271.38Helicase_C464-567 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| LXL04_018950 | PF00270.36 | DEAD | 251 | 421 | 1.2e-52 | 178.7 |
| LXL04_018950 | PF00271.38 | Helicase_C | 464 | 567 | 4.8e-30 | 104.8 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.