TkA03G016220 | RubberDandelionOmics

Gene overview

TkA03G016220

Reference: TK1151 Chr: Chr03 Coordinates: 4181216-4182227 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

928 bp · TkA03G016220|TK1151|cDNA

CCCAAACCCGCGAACCAACTAGAAGCTTTCAAGCAGACGTCTATACGCTTTCATGGAATCATGGCTTACGCCCCAAGTCAAATCCAAAGCTATATATGAACTCTCCCCCCAAATATCCCCAATGCAAAATCGAATTCACAGATTATCCATTTCACTTTCTTCATCCATTAATTTGCTTTTAAGATCAAGAGACTCACCATGGCAGGAACAGAAGCTTTTCCAGATTTAGGCAGACACTGTCAGCTCCCCGATTGCAACCA...

CDS

Download CDS FASTA

588 bp · TkA03G016220|TK1151|CDS

ATGGCAGGAACAGAAGCTTTTCCAGATTTAGGCAGACACTGTCAGCTCCCCGATTGCAACCAGCTCGATTTTCTCCCTTTCAAATGCGCCGGTTGCGAAAAGGTTTTTTGCGTTGAACATCGATCGTACAAGTCTCACGAATGTTCAAACTCCGATCACAACAGTAGAAAAGTTGTGGTCTGTGACACATGCTCCATGTCGATCGAGATTCCACGAAACAGAAAAGGAGTGGTAGAAGAAGAAGATGTTCAGAACGGTTT...

Protein

Download Protein FASTA

195 aa · TkA03G016220|TK1151|PROTEIN

MAGTEAFPDLGRHCQLPDCNQLDFLPFKCAGCEKVFCVEHRSYKSHECSNSDHNSRKVVVCDTCSMSIEIPRNRKGVVEEEDVQNGLILEKHRRSGDCDPKKKKKPTCGVRRCKEILTFSNTSTCKSCEMKFCLKHRFQADHLCKSKNLQAVAAGGGARPFLVALASRMGEACTKKTSGSGSSSASTPSTSVKAY

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G016220`
TK1151 ID	TkA03G016220
OH-1004 ID	LXL04_006186
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	82.200
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G016220

Location Chr03:4181216-4182227 (+)

Description Similar to SAP12: Zinc finger AN1 domain-containing stress-associated protein 12

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g28210`	May be involved in environmental stress response.	No verified direct reference in this release
`At2g41835`	May be involved in environmental stress response.	No verified direct reference in this release
`At3g57480`	May be involved in environmental stress response.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os09g0385700`	May be involved in environmental stress response.	No verified direct reference in this release
`Os07g0569700`	May be involved in environmental stress response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006186 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0097501 stress response to metal ion Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0000976 transcription cis-regulatory region binding Molecular Function

GO:0008270 zinc ion binding Molecular Function

KEGG gene cross-reference

ath:AT2G41835

ath:AT3G28210

ath:AT3G57480

dosa:Os07g0569700

dosa:Os09g0385700

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.529

Rank 1 · TkA03G016220 · TK1151

Nucleus0.465

Rank 2 · TkA03G016220 · TK1151

Mitochondrion0.062

Rank 3 · TkA03G016220 · TK1151

Cell membrane0.052

Rank 4 · TkA03G016220 · TK1151

Golgi apparatus0.042

Rank 5 · TkA03G016220 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF04236Transp_Tc5_C13-48 aa

PF01428zf-AN114-51 aa

PF04236Transp_Tc5_C45-65 aa

PF01428zf-AN158-65 aa

PF04236Transp_Tc5_C101-144 aa

PF01428zf-AN1108-147 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G016220	`PF04236`	Transp_Tc5_C	13	48	0.095	13.8
TkA03G016220	`PF01428`	zf-AN1	14	51	8.6e-22	77.7
TkA03G016220	`PF04236`	Transp_Tc5_C	45	65	0.095	13.8
TkA03G016220	`PF01428`	zf-AN1	58	65	8.6e-22	77.7
TkA03G016220	`PF04236`	Transp_Tc5_C	101	144	0.095	13.8
TkA03G016220	`PF01428`	zf-AN1	108	147	8.6e-22	77.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q67YE6`	Arabidopsis thaliana	sp\|Q67YE6\|SAP12_ARATH Zinc finger AN1 domain-containing stress-associated protein 12	55.800%	Swiss-Prot	High
`Q8VZ42`	Arabidopsis thaliana	sp\|Q8VZ42\|SAP11_ARATH Zinc finger AN1 and C2H2 domain-containing stress-associated protein 11	45.200%	Swiss-Prot	Medium
`Q9SCM4`	Arabidopsis thaliana	sp\|Q9SCM4\|SAP13_ARATH Zinc finger AN1 and C2H2 domain-containing stress-associated protein 13	45.200%	Swiss-Prot	Medium
`Q6H595`	Oryza sativa subsp. japonica	sp\|Q6H595\|SAP17_ORYSJ Zinc finger AN1 domain-containing stress-associated protein 17	57.000%	Swiss-Prot	High
`Q0D5B9`	Oryza sativa subsp. japonica	sp\|Q0D5B9\|SAP16_ORYSJ Zinc finger AN1 and C2H2 domain-containing stress-associated protein 16	44.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card