TkA03G010230 | RubberDandelionOmics

Gene overview

TkA03G010230

Reference: TK1151 Chr: Chr03 Coordinates: 2530308-2543847 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

5732 bp · TkA03G010230|TK1151|cDNA

TATGTGCATGACTATACATTTGTGGACGAGTAATGAAATTTACTGGTTTTAGCCTTTCCTGACTCATAGACCATAAACCCAAAATGTGTACCCTCGTGTTCCGGTAACGTCAACACACGTTTCGCCGGCGACTCTCCGTCGACAAAAATGGACTCGTTTCATCCTCTGCTTGAGAGAATTCGGCTGCCTCAACCGTCACTCCAAACACTGGCGGTTATCTCCATATTCGAGAAGCTCCGATCACCTTCTACACTCACTGG...

CDS

Download CDS FASTA

5412 bp · TkA03G010230|TK1151|CDS

ATGGACTCGTTTCATCCTCTGCTTGAGAGAATTCGGCTGCCTCAACCGTCACTCCAAACACTGGCGGTTATCTCCATATTCGAGAAGCTCCGATCACCTTCTACACTCACTGGACCCGAATCCGACCCGGGAATACACGCCGTTACTCAATGCCTGAACTCAAATTCGCCGGCCGTTGTTGATCAATCAGTCCGAGAGCTCTGTCTTCTTGTAAAGGACTCGAAATTGGAACTTCCTCGGGGGTTGATGGAACTCCAGTC...

Protein

Download Protein FASTA

1803 aa · TkA03G010230|TK1151|PROTEIN

MDSFHPLLERIRLPQPSLQTLAVISIFEKLRSPSTLTGPESDPGIHAVTQCLNSNSPAVVDQSVRELCLLVKDSKLELPRGLMELQSALEGTDSRFVNVFVKAIGFLVQLGFRNDHVRFRFQFSEAHPFVKIVSCRREVQSELVRQVLLFIIQNKHLGMEGVCEFLRPFLNFLVIQMSSSATMSSLARNLLSSIASLCCSFPQDAIPVFKLLMRSCKYVHCNNTEDVTNVSYIMETIVDAFVAVLSHLATNGVLIHDAQL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G010230`
TK1151 ID	TkA03G010230
OH-1004 ID	LXL04_006113
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	99.500
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G010230

Location Chr03:2530308-2543847 (+)

Description Similar to RST1: Protein RST1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g27670`	Involved in cuticular wax formation.	Mutation of the RESURRECTION1 locus of Arabidopsis reveals an association of cuticular wax with embryo development.2005 · DOI: 10.1104/pp.105.066753 The Arabidopsis RESURRECTION1 gene regulates a novel antagonistic interaction in plant defense to biotrophs and necrotrophs.2009 · DOI: 10.1104/pp.109.142158 A genetics screen highlights emerging roles for CPL3, RST1 and URT1 in RNA metabolism and silencing.2019 · DOI: 10.1038/s41477-019-0419-7 RST1 Is a FREE1 Suppressor That Negatively Regulates Vacuolar Trafficking in Arabidopsis.2019 · DOI: 10.1105/tpc.19.00003 RST1 and RIPR connect the cytosolic RNA exosome to the Ski complex in Arabidopsis.2019 · DOI: 10.1038/s41467-019-11807-4

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006113 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006629 lipid metabolic process Biological Process

GO:0006952 defense response Biological Process

GO:0009793 embryo development ending in seed dormancy Biological Process

GO:0010143 cutin biosynthetic process Biological Process

GO:0043447 alkane biosynthetic process Biological Process

GO:0048316 seed development Biological Process

GO:0060147 regulation of post-transcriptional gene silencing Biological Process

GO:1900369 negative regulation of post-transcriptional gene silencing by regulatory ncRNA Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0005925 focal adhesion Cellular Component

KEGG gene cross-reference

ath:AT3G27670

dre:100150998

hsa:54914

mmu:230393

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.513

Rank 1 · TkA03G010230 · TK1151

Cytoplasm0.363

Rank 2 · TkA03G010230 · TK1151

Golgi apparatus0.079

Rank 3 · TkA03G010230 · TK1151

Endoplasmic reticulum0.070

Rank 4 · TkA03G010230 · TK1151

Cell membrane0.069

Rank 5 · TkA03G010230 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12530DUF373082-347 aa

PF24140TPR_TNPO3_IPO13_3rd160-199 aa

PF12530DUF3730546-757 aa

PF24140TPR_TNPO3_IPO13_3rd566-643 aa

PF04116FA_hydroxylase850-894 aa

PF25422DUF7892994-1057 aa

PF20649COG5_C1056-1096 aa

PF04116FA_hydroxylase1366-1472 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G010230	`PF12530`	DUF3730	82	347	8e-99	330.5
TkA03G010230	`PF24140`	TPR_TNPO3_IPO13_3rd	160	199	0.0027	18.6
TkA03G010230	`PF12530`	DUF3730	546	757	8e-99	330.5
TkA03G010230	`PF24140`	TPR_TNPO3_IPO13_3rd	566	643	0.0027	18.6
TkA03G010230	`PF04116`	FA_hydroxylase	850	894	5.4	8.2
TkA03G010230	`PF25422`	DUF7892	994	1057	0.14	12.3
TkA03G010230	`PF20649`	COG5_C	1056	1096	0.051	14.2
TkA03G010230	`PF04116`	FA_hydroxylase	1366	1472	5.4	8.2
TkA03G010230	`PF20649`	COG5_C	1481	1549	0.051	14.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q7XZF5`	Arabidopsis thaliana	sp\|Q7XZF5\|RST1_ARATH Protein RST1	45.900%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card