TkA03G009300 | RubberDandelionOmics

Gene overview

TkA03G009300

Reference: TK1151 Chr: Chr03 Coordinates: 2310672-2311019 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

348 bp · TkA03G009300|TK1151|cDNA

ATGCTGGATCGTGGTGGTGATAAGATCTGTTACGTTCAATTCCCGCAGAGGTTTGAAGGGATTGGCCCTAGTGATCGTTATGCGAATCACAACACTGTTTTCTTCGATGTGAGCATGAGAGCTCTTGATGGCTTGCAAGGTCCGATGTATGTCAGCACCGGCTGTATTTTCCGGCGAATTGCGCTTTACGGGTTTAGCCCTCCTCGAGCGACCGAACACCATGGATGGTTTGGTGAGAAGAAGATCAAGTTCTCGTTGAA...

CDS

Download CDS FASTA

348 bp · TkA03G009300|TK1151|CDS

ATGCTGGATCGTGGTGGTGATAAGATCTGTTACGTTCAATTCCCGCAGAGGTTTGAAGGGATTGGCCCTAGTGATCGTTATGCGAATCACAACACTGTTTTCTTCGATGTGAGCATGAGAGCTCTTGATGGCTTGCAAGGTCCGATGTATGTCAGCACCGGCTGTATTTTCCGGCGAATTGCGCTTTACGGGTTTAGCCCTCCTCGAGCGACCGAACACCATGGATGGTTTGGTGAGAAGAAGATCAAGTTCTCGTTGAA...

Protein

Download Protein FASTA

115 aa · TkA03G009300|TK1151|PROTEIN

MLDRGGDKICYVQFPQRFEGIGPSDRYANHNTVFFDVSMRALDGLQGPMYVSTGCIFRRIALYGFSPPRATEHHGWFGEKKIKFSLKRLKKNKTDEDTEMILPIVDDRNNNEEDD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA03G009300`
TK1151 ID	TkA03G009300
OH-1004 ID	LXL04_006102
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 97.458 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA03G009300

Location Chr03:2310672-2311019 (-)

Description Similar to CSLD4: Cellulose synthase-like protein D4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02730`	Involved in stem and root growth.	Disruption of ATCSLD5 results in reduced growth, reduced xylan and homogalacturonan synthase activity and altered xylan occurrence in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03281.x
`At3g03050`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	AtCSLD3, a cellulose synthase-like gene important for root hair growth in arabidopsis.2001 · DOI: 10.1104/pp.126.2.575

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0555600`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`UniProt: A2YCI3`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`Os06g0336500`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006102 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000919 cell plate assembly Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009625 response to insect Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0009846 pollen germination Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0048367 shoot system development Biological Process

GO:0071555 cell wall organization Biological Process

KEGG gene cross-reference

ath:AT1G02730

ath:AT2G33100

ath:AT3G03050

dosa:Os06g0336500

dosa:Os12g0555600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.414

Rank 1 · TkA03G009300 · TK1151

Cytoplasm0.340

Rank 2 · TkA03G009300 · TK1151

Mitochondrion0.139

Rank 3 · TkA03G009300 · TK1151

Cell membrane0.076

Rank 4 · TkA03G009300 · TK1151

Extracellular0.071

Rank 5 · TkA03G009300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03552Cellulose_synt1-99 aa

PF29364TED650-57 aa

PF29364TED684-101 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA03G009300	`PF03552`	Cellulose_synt	1	99	1.2e-40	140.5
TkA03G009300	`PF29364`	TED6	50	57	0.22	12.2
TkA03G009300	`PF29364`	TED6	84	101	0.22	12.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRW9`	Arabidopsis thaliana	sp\|Q9SRW9\|CSLD5_ARATH Cellulose synthase-like protein D5	75.700%	Swiss-Prot	High
`Q9M9M4`	Arabidopsis thaliana	sp\|Q9M9M4\|CSLD3_ARATH Cellulose synthase-like protein D3	63.500%	Swiss-Prot	High
`Q2QNS6`	Oryza sativa subsp. japonica	sp\|Q2QNS6\|CSLD4_ORYSJ Cellulose synthase-like protein D4	73.200%	Swiss-Prot	High
`A2YCI3`	Oryza sativa subsp. indica	sp\|A2YCI3\|CSLD5_ORYSI Putative cellulose synthase-like protein D5	78.000%	Swiss-Prot	High
`Q5Z6E5`	Oryza sativa subsp. japonica	sp\|Q5Z6E5\|CSLD5_ORYSJ Cellulose synthase-like protein D5	78.000%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card