LXL04_006102 | RubberDandelionOmics

Gene overview

LXL04_006102

Reference: OH-1004 Chr: Chr02 Coordinates: 1713732-1714088 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

357 bp · LXL04_006102|LXL04_006102|OH1004|cDNA

ATGTGTTTCATGCTAGATCGTGGTGGTGATAAGATCTGTTACGTTCAATTCCCGCAGAGGTTTGAAGGGATTGGCCCTAGTGATCGTTATGCGAATCACAACACTGTTTTCTTCGATGTGAGCATGAGAGCTCTTGATGGCTTGCAAGGTCCGATGTATGTCAGCACCGGCTGTATTTTCCGGCGAATTGCGCTTTACGGGTTTAGCCCTCCTCGAGCGACCGAACACCATGGATGGTTTGGTGAGAAGAAGATCAAGTT...

CDS

Download CDS FASTA

357 bp · LXL04_006102|LXL04_006102|OH1004|CDS

ATGTGTTTCATGCTAGATCGTGGTGGTGATAAGATCTGTTACGTTCAATTCCCGCAGAGGTTTGAAGGGATTGGCCCTAGTGATCGTTATGCGAATCACAACACTGTTTTCTTCGATGTGAGCATGAGAGCTCTTGATGGCTTGCAAGGTCCGATGTATGTCAGCACCGGCTGTATTTTCCGGCGAATTGCGCTTTACGGGTTTAGCCCTCCTCGAGCGACCGAACACCATGGATGGTTTGGTGAGAAGAAGATCAAGTT...

Protein

Download Protein FASTA

118 aa · LXL04_006102|LXL04_006102|OH1004|PROTEIN

MCFMLDRGGDKICYVQFPQRFEGIGPSDRYANHNTVFFDVSMRALDGLQGPMYVSTGCIFRRIALYGFSPPRATEHHGWFGEKKIKFSLKRLKKNKTDEDTEMILPIVDDRNNNEEDD

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006102`
TK1151 ID	TkA03G009300
OH-1004 ID	LXL04_006102
Relationship / confidence	Multi Candidate From Tk1151 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 100.000 / OH-1004 97.458 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006102

Location Chr02:1713732-1714088 (-)

Description Similar to CSLD4: Cellulose synthase-like protein D4

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At1g02730`	Involved in stem and root growth.	Disruption of ATCSLD5 results in reduced growth, reduced xylan and homogalacturonan synthase activity and altered xylan occurrence in Arabidopsis.2007 · DOI: 10.1111/j.1365-313x.2007.03281.x
`At3g03050`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	AtCSLD3, a cellulose synthase-like gene important for root hair growth in arabidopsis.2001 · DOI: 10.1104/pp.126.2.575
`At2g33100`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os12g0555600`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release
`Os06g0336500`	Thought to be a Golgi-localized beta-glycan synthase that polymerize the backbones of noncellulosic polysaccharides (hemicelluloses) of plant cell wall.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006102 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000919 cell plate assembly Biological Process

GO:0006970 response to osmotic stress Biological Process

GO:0009409 response to cold Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009625 response to insect Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009833 plant-type primary cell wall biogenesis Biological Process

GO:0009846 pollen germination Biological Process

GO:0030244 cellulose biosynthetic process Biological Process

GO:0042546 cell wall biogenesis Biological Process

GO:0048367 shoot system development Biological Process

GO:0071555 cell wall organization Biological Process

KEGG gene cross-reference

ath:AT1G02730

ath:AT2G33100

ath:AT3G03050

dosa:Os06g0336500

dosa:Os12g0555600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.449

Rank 1 · LXL04_006102 · OH-1004

Cytoplasm0.362

Rank 2 · LXL04_006102 · OH-1004

Mitochondrion0.148

Rank 3 · LXL04_006102 · OH-1004

Cell membrane0.073

Rank 4 · LXL04_006102 · OH-1004

Extracellular0.059

Rank 5 · LXL04_006102 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF03552.21Cellulose_synt1-102 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006102	`PF03552.21`	Cellulose_synt	1	102	6.8e-44	151.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SRW9`	Arabidopsis thaliana	Cellulose synthase-like protein D5	76.271%	Swiss-Prot	strong database homology
`Q9M9M4`	Arabidopsis thaliana	Cellulose synthase-like protein D3	61.600%	Swiss-Prot	strong database homology
`O49323`	Arabidopsis thaliana	Cellulose synthase-like protein D1	79.762%	Swiss-Prot	strong database homology
`Q2QNS6`	Oryza sativa subsp. japonica	Cellulose synthase-like protein D4	71.304%	Swiss-Prot	strong database homology
`Q5Z6E5`	Oryza sativa subsp. japonica	Cellulose synthase-like protein D5	77.647%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card