Gene Card
Gene overview
cDNA / CDS / Protein Sequences
1863 bp · TkA03G007300|TK1151|cDNA
AGAGTAAAACACATACTAACCCGATTATCCGAAATTCCGAATACCAAGCAGGCGAGTTTACTCACAAGACACCACCATCAACAAGACAACAATGGCTTCACCAACCACAGATGATAAACAGAGACCTGCTAAGAGAGTCGCTGTTGTTGGTGCCGGTGTCAGTGGCCTTGCTGCTGCATATAAGCTAAAGGTACATGGATTGAACGTCACTGTATTTGAAGCTGATGGAAGAGCCGGAGGGAAACTAAGAAGCATTTCAC...
2241 bp · TkA03G007300|TK1151|CDS
ATGGCGGTTTCAATTAAGCGTGCAGTGATATCGTGTCGCAACATCTATCCTTTGCTACGATCATCTCGCCGGATTTCTCAATGTGCAGCCTCTCCATATTTCCTGAAAACAGTCAGTGATCCGCGTCCGGTGTTTTCCAGTTCGCCGGCGATTGGTTTTCCATTCGAATCTCGCAGATCATTTGCCAAAGCACGAAAGAAATGGGATGACGATGACACTGGCGAACTTGATGTTGCTAACGGCGATGCTGCGAGCAGAAT...
Protein
Download Protein FASTA746 aa · TkA03G007300|TK1151|PROTEIN
MAVSIKRAVISCRNIYPLLRSSRRISQCAASPYFLKTVSDPRPVFSSSPAIGFPFESRRSFAKARKKWDDDDTGELDVANGDAASRIEIVNIGPIIKSTAISEMEAAIDAVSHELSKLRTGRASAGMLDHIIVETGGVKMPLNRMAVVSVLDPKTLSALKELEKAIVSSPLGLNPKPDGERLITAIPPMTKEHMQAVCKVVAKSSEDAKQRIRRARQKAIDTIKKSLPKKSEGKNKGKDKENVKTNKTVSGFSSDDAKRL...
Flanking Sequence Download
Sequence orientation and download details
Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.
ID Mapping
| Input ID | TkA03G007300 |
|---|---|
| TK1151 ID | TkA03G007300 |
| OH-1004 ID | LXL04_006054 |
| Relationship / confidence | Rbh High Identity Coverage Synteny / Strict |
| Protein identity (%) | 97.700 |
| Protein coverage (%) | TK1151 100.000 / OH-1004 100.000Coverage and evidenceCoverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation. |
| Source version | TK1151 / GWHBCHF00000000 |
SNP / Indel variants and carrier samplesCRA009020 · TK1151
Expand to load variant records for this gene.
Basic Information and Functional Annotation
| Gene ID | TkA03G007300 | ||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Location | Chr03:1751188-1757789 (-) | ||||||||||||
| Description | Similar to PPXII: Protoporphyrinogen oxidase, mitochondrial | ||||||||||||
| Arabidopsis / Rice Reference Genes and Papers |
Download references for this gene Arabidopsis
Rice
| ||||||||||||
| Functional annotation source | View annotation sourcesFunctional annotation source: OH1004 · | ||||||||||||
| GO annotations (OH1004 source) | GO:0006779 porphyrin-containing compound biosynthetic process Biological Process GO:0006782 protoporphyrinogen IX biosynthetic process Biological Process GO:0006783 heme biosynthetic process Biological Process GO:0009793 embryo development ending in seed dormancy Biological Process GO:0015995 chlorophyll biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0005739 mitochondrion Cellular Component GO:0005743 mitochondrial inner membrane Cellular Component GO:0005886 plasma membrane Cellular Component GO:0009507 chloroplast Cellular Component GO:0009534 chloroplast thylakoid Cellular Component GO:0009536 plastid Cellular Component | ||||||||||||
| KEGG gene cross-reference | ath:AT5G14220 nta:107815753 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene. |
Gene expression
View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.
Data sources and gene correspondence
Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.
Subcellular Localization Top 5
Computational predictions or homology annotations below do not replace localization experiments.
LocPro · Direct prediction · Computational prediction, not experimental localization
Predicted Functional Domains
Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.
PF01765RRF112-286 aaPF27104FimW_N138-220 aaPF10312Cactin_mid147-167 aaPF01494FAD_binding_3179-226 aaPF07889DUF1664190-272 aaPF12831FAD_oxidored191-247 aaPF27285AlgP_helical192-267 aaPF19352TetR_C_38193-246 aa| Gene ID | Domain ID | Domain Name | Start aa | End aa | E-value | Score |
|---|---|---|---|---|---|---|
| TkA03G007300 | PF01765 | RRF | 112 | 286 | 1.3e-37 | 129.9 |
| TkA03G007300 | PF27104 | FimW_N | 138 | 220 | 0.11 | 12.7 |
| TkA03G007300 | PF10312 | Cactin_mid | 147 | 167 | 0.0048 | 17.3 |
| TkA03G007300 | PF01494 | FAD_binding_3 | 179 | 226 | 0.04 | 13.9 |
| TkA03G007300 | PF07889 | DUF1664 | 190 | 272 | 9.8 | 7.0 |
| TkA03G007300 | PF12831 | FAD_oxidored | 191 | 247 | 7e-05 | 23.0 |
| TkA03G007300 | PF27285 | AlgP_helical | 192 | 267 | 5.1 | 8.0 |
| TkA03G007300 | PF19352 | TetR_C_38 | 193 | 246 | 0.72 | 10.6 |
| TkA03G007300 | PF01134 | GIDA | 196 | 277 | 0.79 | 9.4 |
| TkA03G007300 | PF06428 | Sec2p | 196 | 271 | 1.6 | 9.7 |
| TkA03G007300 | PF10312 | Cactin_mid | 204 | 270 | 0.0048 | 17.3 |
| TkA03G007300 | PF00070 | Pyr_redox | 213 | 245 | 0.0017 | 19.6 |
| TkA03G007300 | PF02737 | 3HCDH_N | 215 | 249 | 4.3 | 7.9 |
| TkA03G007300 | PF07992 | Pyr_redox_2 | 237 | 325 | 3.2e-05 | 24.2 |
| TkA03G007300 | PF19352 | TetR_C_38 | 266 | 307 | 0.72 | 10.6 |
| TkA03G007300 | PF13738 | Pyr_redox_3 | 282 | 323 | 0.074 | 13.0 |
Arabidopsis / Rice Protein Homology
Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.