TkA02G615790 | RubberDandelionOmics

Gene overview

TkA02G615790

Reference: TK1151 Chr: Chr02 Coordinates: 158733927-158735432 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1011 bp · TkA02G615790|TK1151|cDNA

GATGTGCCCGACGCCGATATCGCTGCATCTCTATTCTCTCATACTAACGCCACTACAGCAGCCGCAGTCACTGATTAAGCATGCCGGGGCCTATCGTCGAAGATATTCAGTCTGAGAAGGAGGTCCAGCACGACGAACACCCAGTGATCGAGGACGTTAACGAGGAAGATGACCACGAAGACATAGATGCTGATTCCGACGATGACCAGGAAGATGGTGCACAAGGTGGGGTTGAGGGTGCAAAGCAAAGCAGAAGTGAG...

CDS

Download CDS FASTA

585 bp · TkA02G615790|TK1151|CDS

ATGCCGGGGCCTATCGTCGAAGATATTCAGTCTGAGAAGGAGGTCCAGCACGACGAACACCCAGTGATCGAGGACGTTAACGAGGAAGATGACCACGAAGACATAGATGCTGATTCCGACGATGACCAGGAAGATGGTGCACAAGGTGGGGTTGAGGGTGCAAAGCAAAGCAGAAGTGAGAAGAAGAGTCGAAAGGCAATGTTGAAGCTGGGGATGAAACCACTTGTTGGTGTGAGCAGGGTAACCATTAAAAGGACAAA...

Protein

Download Protein FASTA

194 aa · TkA02G615790|TK1151|PROTEIN

MPGPIVEDIQSEKEVQHDEHPVIEDVNEEDDHEDIDADSDDDQEDGAQGGVEGAKQSRSEKKSRKAMLKLGMKPLVGVSRVTIKRTKMVMFFISKPDVFKSPNSETYVIFGEAKIEDLSSQLQTQAAQQFRMPDMGSVMAKPDAQMAAIEEEEEEEEEVDDTGVEARDVELVMTQAGVSQSQRRSKLSRHTMGT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G615790`
TK1151 ID	TkA02G615790
OH-1004 ID	LXL04_011790
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.100
Protein coverage (%)	TK1151 97.938 / OH-1004 94.273 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G615790

Location Chr02:158733927-158735432 (+)

Description Similar to At3g49470: Nascent polypeptide-associated complex subunit alpha-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49470`	May promote appropriate targeting of ribosome-nascent polypeptide complexes.	No verified direct reference in this release
`At4g10480`	May promote appropriate targeting of ribosome-nascent polypeptide complexes.	No verified direct reference in this release
`At1g33040`	May promote appropriate targeting of ribosome-nascent polypeptide complexes.	No verified direct reference in this release
`At3g12390`	May promote appropriate targeting of ribosome-nascent polypeptide complexes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011790 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0015031 protein transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005854 nascent polypeptide-associated complex Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0051082 unfolded protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G33040

ath:AT3G12390

ath:AT3G49470

ath:AT4G10480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.769

Rank 1 · TkA02G615790 · TK1151

Nucleus0.428

Rank 2 · TkA02G615790 · TK1151

Endoplasmic reticulum0.066

Rank 3 · TkA02G615790 · TK1151

Cell membrane0.039

Rank 4 · TkA02G615790 · TK1151

Mitochondrion0.035

Rank 5 · TkA02G615790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11719Drc1-Sld25-179 aa

PF02724CDC458-63 aa

PF28081MXAN_6627_516-64 aa

PF23048SH3-A_UBE2O19-66 aa

PF05477SURF224-65 aa

PF01849NAC60-115 aa

PF02724CDC45101-168 aa

PF05477SURF2124-188 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G615790	`PF11719`	Drc1-Sld2	5	179	6.8	7.0
TkA02G615790	`PF02724`	CDC45	8	63	3.4	6.5
TkA02G615790	`PF28081`	MXAN_6627_5	16	64	0.86	10.4
TkA02G615790	`PF23048`	SH3-A_UBE2O	19	66	0.18	13.3
TkA02G615790	`PF05477`	SURF2	24	65	3.7	7.8
TkA02G615790	`PF01849`	NAC	60	115	2e-20	73.2
TkA02G615790	`PF02724`	CDC45	101	168	3.4	6.5
TkA02G615790	`PF05477`	SURF2	124	188	3.7	7.8
TkA02G615790	`PF28081`	MXAN_6627_5	126	164	0.86	10.4
TkA02G615790	`PF23048`	SH3-A_UBE2O	150	163	0.18	13.3
TkA02G615790	`PF19026`	UBA_HYPK	163	182	0.011	15.9
TkA02G615790	`PF01849`	NAC	168	182	2e-20	73.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94JX9`	Arabidopsis thaliana	sp\|Q94JX9\|NACA2_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 2	69.000%	Swiss-Prot	Medium
`Q9SZY1`	Arabidopsis thaliana	sp\|Q9SZY1\|NACA4_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 4	67.800%	Swiss-Prot	Medium
`Q8LGC6`	Arabidopsis thaliana	sp\|Q8LGC6\|NACA5_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 5	66.100%	Swiss-Prot	Medium
`Q9LHG9`	Arabidopsis thaliana	sp\|Q9LHG9\|NACA1_ARATH Nascent polypeptide-associated complex subunit alpha-like protein 1	64.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card