LXL04_011790 | RubberDandelionOmics

Gene overview

LXL04_011790

Reference: OH-1004 Chr: Chr03 Coordinates: 180046-181154 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

684 bp · LXL04_011790|LXL04_011790|OH1004|cDNA

ATGCCGGGGCCTATCGTCGAAGATATTCAGTCTGAGAAGGAGGTCCAGCACGACGAACACCCAGTGATCGAGGACGTTAACGAGGAAGATGACCACGAAGACATAGATGCTGATTCCGACGATGACCAGGAAGATGGTGCACAAGGTGGGGTTGAGGGTGCAAAGCAAAGCAGAAGTGAGAAGAAGAGTCGAAAGGCAATGTTGAAGCTGGGGATGAAACCACTTGTTGGTGTGAGCAGGGTAACCATTAAAaggacaaa...

CDS

Download CDS FASTA

684 bp · LXL04_011790|LXL04_011790|OH1004|CDS

ATGCCGGGGCCTATCGTCGAAGATATTCAGTCTGAGAAGGAGGTCCAGCACGACGAACACCCAGTGATCGAGGACGTTAACGAGGAAGATGACCACGAAGACATAGATGCTGATTCCGACGATGACCAGGAAGATGGTGCACAAGGTGGGGTTGAGGGTGCAAAGCAAAGCAGAAGTGAGAAGAAGAGTCGAAAGGCAATGTTGAAGCTGGGGATGAAACCACTTGTTGGTGTGAGCAGGGTAACCATTAAAAGGACAAA...

Protein

Download Protein FASTA

227 aa · LXL04_011790|LXL04_011790|OH1004|PROTEIN

MPGPIVEDIQSEKEVQHDEHPVIEDVNEEDDHEDIDADSDDDQEDGAQGGVEGAKQSRSEKKSRKAMLKLGMKPLVGVSRVTIKRTKNVRWLTNHYLFLFVWALADWVEILQVMFFISKPDVFKSPNSETYVIFGEAKIEDLSSQLQTQAAQQFRMPDMGSVMAKPDAQMAAIEEEEEEEEEVDDTGVEARDVELVMTQAGVSKPKAVKALKTHNGDIVSAIMELTT

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_011790`
TK1151 ID	TkA02G615790
OH-1004 ID	LXL04_011790
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	84.100
Protein coverage (%)	TK1151 97.938 / OH-1004 94.273 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_011790

Location Chr03:180046-181154 (-)

Description Similar to At3g49470: Nascent polypeptide-associated complex subunit alpha-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g49470`	May promote appropriate targeting of ribosome-nascent polypeptide complexes.	No verified direct reference in this release
`At4g10480`	May promote appropriate targeting of ribosome-nascent polypeptide complexes.	No verified direct reference in this release
`At1g33040`	May promote appropriate targeting of ribosome-nascent polypeptide complexes.	No verified direct reference in this release
`At3g12390`	May promote appropriate targeting of ribosome-nascent polypeptide complexes.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011790 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006612 protein targeting to membrane Biological Process

GO:0015031 protein transport Biological Process

GO:0005634 nucleus Cellular Component

GO:0005737 cytoplasm Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005854 nascent polypeptide-associated complex Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0003729 mRNA binding Molecular Function

GO:0051082 unfolded protein binding Molecular Function

KEGG gene cross-reference

ath:AT1G33040

ath:AT3G12390

ath:AT3G49470

ath:AT4G10480

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.743

Rank 1 · LXL04_011790 · OH-1004

Nucleus0.433

Rank 2 · LXL04_011790 · OH-1004

Endoplasmic reticulum0.072

Rank 3 · LXL04_011790 · OH-1004

Mitochondrion0.051

Rank 4 · LXL04_011790 · OH-1004

Cell membrane0.050

Rank 5 · LXL04_011790 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01849.24NAC60-88 aa

PF01849.24NAC114-139 aa

PF19026.8UBA_HYPK187-226 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_011790	`PF01849.24`	NAC	60	88	2.9e-16	59.8
LXL04_011790	`PF01849.24`	NAC	114	139	2.9e-16	59.8
LXL04_011790	`PF19026.8`	UBA_HYPK	187	226	4e-14	52.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q94JX9`	Arabidopsis thaliana	Nascent polypeptide-associated complex subunit alpha-like protein 2	63.134%	Swiss-Prot	strong database homology
`Q9SZY1`	Arabidopsis thaliana	Nascent polypeptide-associated complex subunit alpha-like protein 4	55.932%	Swiss-Prot	strong database homology
`Q8LGC6`	Arabidopsis thaliana	Nascent polypeptide-associated complex subunit alpha-like protein 5	64.607%	Swiss-Prot	strong database homology
`Q9LHG9`	Arabidopsis thaliana	Nascent polypeptide-associated complex subunit alpha-like protein 1	57.923%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card