TkA02G611680 | RubberDandelionOmics

Gene overview

TkA02G611680

Reference: TK1151 Chr: Chr02 Coordinates: 157784996-157790580 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1836 bp · TkA02G611680|TK1151|cDNA

CAAATACTCCCTTCCAACCCGATCTCAACCCACCATCACCTCCTGCATCTTCTCTCTCTAAACTAACCGGATAAACACCATTCCAATTATTCTTCCACAATGAGGAGCAATCTGAAGTCCAATTCCTGGAAGTTTACGAGACTCTGAAATCAGAGCTAATTCATGATCCTGCATTTGAGTTCGACGACGATTCTCGTCAGTGGGTTGAACGGATGCTTGACTACAATGTACCTGGAGGAAAGTTAAACAGAGGCCTTTCT...

CDS

Download CDS FASTA

306 bp · TkA02G611680|TK1151|CDS

ATGGAATTCTTGGTTTCGAAGAGTTTGCTCGTGCACTATCAGTATTCCATCCAAATGCCCCCATTGATGATAAGATCGAGTCAACAAGGTTTTATAGAGAGGCAAGAGGTGAAGCAAATGGTGGTGGCTACTCTTGCTGAATCAGGCATGAATCTTTCCGATGATGTCATTGAGAGTATCATTGACAAGACGTTTGAGGAAGCTGATACAAAACATGATGGGAAGATAGACAAGGAAGAATGGAGAAGCCTTGTGCTCAG...

Protein

Download Protein FASTA

101 aa · TkA02G611680|TK1151|PROTEIN

MEFLVSKSLLVHYQYSIQMPPLMIRSSQQGFIERQEVKQMVVATLAESGMNLSDDVIESIIDKTFEEADTKHDGKIDKEEWRSLVLRHPSLLKNMTLQYLK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G611680`
TK1151 ID	TkA02G611680
OH-1004 ID	LXL04_037266
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	100.000
Protein coverage (%)	TK1151 73.267 / OH-1004 20.963 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G611680

Location Chr02:157784996-157790580 (+)

Description Similar to CBL3: Calcineurin B-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26570`	Acts as a calcium sensor.	A protein kinase, calcineurin B-like protein-interacting protein Kinase9, interacts with calcium sensor calcineurin B-like Protein3 and regulates potassium homeostasis under low-potassium stress in Arabidopsis.2013 · DOI: 10.1104/pp.112.206896
`At5g55990`	Acts as a calcium sensor.	Arabidopsis protein kinase PKS5 inhibits the plasma membrane H+ -ATPase by preventing interaction with 14-3-3 protein.2007 · DOI: 10.1105/tpc.105.035626 S-acylation-dependent association of the calcium sensor CBL2 with the vacuolar membrane is essential for proper abscisic acid responses.2012 · DOI: 10.1038/cr.2012.71

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0626800`	Acts as a calcium sensor.	No verified direct reference in this release
`Os12g0597000`	Acts as a calcium sensor.	A gibberellin-regulated calcineurin B in rice localizes to the tonoplast and is implicated in vacuole function.2005 · DOI: 10.1104/pp.105.062703
`Os12g0162400`	Acts as a calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037266 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0005513 detection of calcium ion Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0032578 aleurone grain membrane Cellular Component

KEGG gene cross-reference

ath:AT4G26570

ath:AT5G55990

dosa:Os03g0626800

dosa:Os12g0162400

dosa:Os12g0597000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.511

Rank 1 · TkA02G611680 · TK1151

Nucleus0.259

Rank 2 · TkA02G611680 · TK1151

Mitochondrion0.140

Rank 3 · TkA02G611680 · TK1151

Endoplasmic reticulum0.134

Rank 4 · TkA02G611680 · TK1151

Cell membrane0.094

Rank 5 · TkA02G611680 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499EF-hand_726-80 aa

PF30624EF_SSP12028-81 aa

PF13405EF-hand_629-41 aa

PF13202EF-hand_530-41 aa

PF00036EF-hand_130-42 aa

PF23564EF-hand_FSTL134-91 aa

PF02457DAC42-75 aa

PF29347CCM1_C44-86 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G611680	`PF13499`	EF-hand_7	26	80	2.4e-10	41.3
TkA02G611680	`PF30624`	EF_SSP120	28	81	0.17	13.3
TkA02G611680	`PF13405`	EF-hand_6	29	41	6.4e-06	26.2
TkA02G611680	`PF13202`	EF-hand_5	30	41	6.8e-10	38.7
TkA02G611680	`PF00036`	EF-hand_1	30	42	6.8e-09	35.4
TkA02G611680	`PF23564`	EF-hand_FSTL1	34	91	0.0016	19.5
TkA02G611680	`PF02457`	DAC	42	75	0.13	12.5
TkA02G611680	`PF29347`	CCM1_C	44	86	0.065	13.8
TkA02G611680	`PF13833`	EF-hand_8	49	85	0.005	17.3
TkA02G611680	`PF10591`	SPARC_Ca_bdg	55	82	0.013	16.5
TkA02G611680	`PF13202`	EF-hand_5	61	85	6.8e-10	38.7
TkA02G611680	`PF00036`	EF-hand_1	61	85	6.8e-09	35.4
TkA02G611680	`PF13405`	EF-hand_6	63	84	6.4e-06	26.2
TkA02G611680	`PF13499`	EF-hand_7	64	88	2.4e-10	41.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LEM7`	Arabidopsis thaliana	sp\|Q8LEM7\|CNBL3_ARATH Calcineurin B-like protein 3	94.600%	Swiss-Prot	High
`Q8LAS7`	Arabidopsis thaliana	sp\|Q8LAS7\|CNBL2_ARATH Calcineurin B-like protein 2	95.900%	Swiss-Prot	High
`Q75LU8`	Oryza sativa subsp. japonica	sp\|Q75LU8\|CNBL3_ORYSJ Calcineurin B-like protein 3	97.300%	Swiss-Prot	High
`Q3HRP5`	Oryza sativa subsp. japonica	sp\|Q3HRP5\|CNBL2_ORYSJ Calcineurin B-like protein 2	93.200%	Swiss-Prot	High
`Q3HRP1`	Oryza sativa subsp. japonica	sp\|Q3HRP1\|CNBL6_ORYSJ Calcineurin B-like protein 6	90.500%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card