LXL04_037266 | RubberDandelionOmics

Gene overview

LXL04_037266

Reference: OH-1004 Chr: Chr09 Coordinates: 4718427-4721974 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1062 bp · LXL04_037266|LXL04_037266|OH1004|cDNA

ATGATCTTGAGGGGTTTTACCTCAGAGGTCTCAGAAGAATTAACAGCAGTAAAAAGACGAAAAAGGCCTTGTCTCGAATCTATCCGTTTGGGGTGGTGTCACGTGATCTGCCTCACCGGTCTCGCCGGGACTACGGATATGTACCCTATCACCATCACCTCCATCAACCATCCTCGTGTCATCTCTCCCATCATTGCATTTAAAGGTAAAATCTTTTCGTCGTTTTTCTCCAATCTCTTCATCCTCCGATTTGAGTTTCT...

CDS

Download CDS FASTA

1062 bp · LXL04_037266|LXL04_037266|OH1004|CDS

ATGATCTTGAGGGGTTTTACCTCAGAGGTCTCAGAAGAATTAACAGCAGTAAAAAGACGAAAAAGGCCTTGTCTCGAATCTATCCGTTTGGGGTGGTGTCACGTGATCTGCCTCACCGGTCTCGCCGGGACTACGGATATGTACCCTATCACCATCACCTCCATCAACCATCCTCGTGTCATCTCTCCCATCATTGCATTTAAAGGTAAAATCTTTTCGTCGTTTTTCTCCAATCTCTTCATCCTCCGATTTGAGTTTCT...

Protein

Download Protein FASTA

353 aa · LXL04_037266|LXL04_037266|OH1004|PROTEIN

MILRGFTSEVSEELTAVKRRKRPCLESIRLGWCHVICLTGLAGTTDMYPITITSINHPRVISPIIAFKGKIFSSFFSNLFILRFEFLFKSFTNQQVSRFRTCKSPLEHNQHNLNLPEEISGCRSSKLSDIYFSSCRKWSKVTIMEHFDVRQVPCLTLEDPEILARETVFSVSEIEALYELFKKISSAVIDDGLINKEEFQLALFKTNKKESLFADRVFDLFDTKHNGILGFEEFARALSVFHPNAPIDDKIEFSFQLYDL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_037266`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_037266

Location Chr09:4718427-4721974 (-)

Description Similar to CBL3: Calcineurin B-like protein 3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g26570`	Acts as a calcium sensor.	A protein kinase, calcineurin B-like protein-interacting protein Kinase9, interacts with calcium sensor calcineurin B-like Protein3 and regulates potassium homeostasis under low-potassium stress in Arabidopsis.2013 · DOI: 10.1104/pp.112.206896
`At5g55990`	Acts as a calcium sensor.	Arabidopsis protein kinase PKS5 inhibits the plasma membrane H+ -ATPase by preventing interaction with 14-3-3 protein.2007 · DOI: 10.1105/tpc.105.035626 S-acylation-dependent association of the calcium sensor CBL2 with the vacuolar membrane is essential for proper abscisic acid responses.2012 · DOI: 10.1038/cr.2012.71

Rice

Reference gene ID	Possible function	Papers / DOI
`Os03g0626800`	Acts as a calcium sensor.	No verified direct reference in this release
`Os12g0597000`	Acts as a calcium sensor.	A gibberellin-regulated calcineurin B in rice localizes to the tonoplast and is implicated in vacuole function.2005 · DOI: 10.1104/pp.105.062703
`Os12g0162400`	Acts as a calcium sensor.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_037266 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0005513 detection of calcium ion Biological Process

GO:0019722 calcium-mediated signaling Biological Process

GO:0055075 potassium ion homeostasis Biological Process

GO:0000325 plant-type vacuole Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009536 plastid Cellular Component

GO:0009705 plant-type vacuole membrane Cellular Component

GO:0016020 membrane Cellular Component

GO:0022626 cytosolic ribosome Cellular Component

GO:0032578 aleurone grain membrane Cellular Component

KEGG gene cross-reference

ath:AT4G26570

ath:AT5G55990

dosa:Os03g0626800

dosa:Os12g0162400

dosa:Os12g0597000

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.435

Rank 1 · LXL04_037266 · OH-1004

Nucleus0.264

Rank 2 · LXL04_037266 · OH-1004

Cell membrane0.189

Rank 3 · LXL04_037266 · OH-1004

Mitochondrion0.120

Rank 4 · LXL04_037266 · OH-1004

Endoplasmic reticulum0.120

Rank 5 · LXL04_037266 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13499.13EF-hand_7190-238 aa

PF00036.39EF-hand_1215-239 aa

PF13499.13EF-hand_7249-314 aa

PF00036.39EF-hand_1295-319 aa

PF13202.13EF-hand_5295-319 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_037266	`PF13499.13`	EF-hand_7	190	238	1.5e-16	61.2
LXL04_037266	`PF00036.39`	EF-hand_1	215	239	2.3e-17	61.9
LXL04_037266	`PF13499.13`	EF-hand_7	249	314	1.5e-16	61.2
LXL04_037266	`PF00036.39`	EF-hand_1	295	319	2.3e-17	61.9
LXL04_037266	`PF13202.13`	EF-hand_5	295	319	2.4e-15	55.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8LEM7`	Arabidopsis thaliana	Calcineurin B-like protein 3	95.431%	Swiss-Prot	moderate database homology
`Q8LAS7`	Arabidopsis thaliana	Calcineurin B-like protein 2	95.939%	Swiss-Prot	moderate database homology
`Q75LU8`	Oryza sativa subsp. japonica	Calcineurin B-like protein 3	95.939%	Swiss-Prot	moderate database homology
`Q3HRP5`	Oryza sativa subsp. japonica	Calcineurin B-like protein 2	91.878%	Swiss-Prot	moderate database homology
`Q3HRP1`	Oryza sativa subsp. japonica	Calcineurin B-like protein 6	89.340%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card