TkA02G611640 | RubberDandelionOmics

Gene overview

TkA02G611640

Reference: TK1151 Chr: Chr02 Coordinates: 157771182-157773519 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1506 bp · TkA02G611640|TK1151|cDNA

CGTTAAACCAGTTAGAGGTCAGCGTTTGCGCTCATGATGTCTTATCTTTGGAAGGCTCACCTCACTGGCTCGCTCACACTTATTATTATATACCCATTTCTACTTGACACTTATTCTTCTTGCAAACTACATCTACTTGATCTCATCAATGGCTTTATGGAGTCCTCGCTTGCAAAGATTTCTACTCAACAACAACGTAAGCAAGATCGACTTGAAGAGGACTAATAGTTATAATAGCAATAATCATATAATTATGAGAA...

CDS

Download CDS FASTA

1194 bp · TkA02G611640|TK1151|CDS

ATGGCTTTATGGAGTCCTCGCTTGCAAAGATTTCTACTCAACAACAACGTAAGCAAGATCGACTTGAAGAGGACTAATAGTTATAATAGCAATAATCATATAATTATGAGAAAGTGGAGTAGAGAAGGCAGCCCCCGGTGTTGTTCGGCGATTGCAATCGACGCCCCTTCTTCTCTCTCTGATGGCCTATCTGGGATTAGATGGGGTTCCGCCAAATTACAAGGTGCCCGGGAAGAGATGGAAGACGATGCTGTTATAGT...

Protein

Download Protein FASTA

397 aa · TkA02G611640|TK1151|PROTEIN

MALWSPRLQRFLLNNNVSKIDLKRTNSYNSNNHIIMRKWSREGSPRCCSAIAIDAPSSLSDGLSGIRWGSAKLQGAREEMEDDAVIVAHNELDGFYFAAVFDGHAGFSSVKFLREELYKECVKALQGGLLLSKKDMNGIKKALQEAFENADAKLLNWLDMNGEEDESGATATTLLVGNNMLFISHVGDSCAVLSVSGKAQELTDSHRPYGRSKVSLKEIKRIREAGGWISDGRICGDISVSRAFGDMRFKTKKKEMLEKG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G611640`
TK1151 ID	TkA02G611640
OH-1004 ID	LXL04_011815
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.300
Protein coverage (%)	TK1151 100.000 / OH-1004 93.764 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G611640

Location Chr02:157771182-157773519 (-)

Description Similar to PPH1: Protein phosphatase 2C 57

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27800`	Protein phosphatase specifically required for efficient dephosphorylation of the light-harvesting complex II outer antennae (LCHII) and transition from state 2 to state 1.	Role of plastid protein phosphatase TAP38 in LHCII dephosphorylation and thylakoid electron flow.2010 · DOI: 10.1371/journal.pbio.1000288 The PPH1 phosphatase is specifically involved in LHCII dephosphorylation and state transitions in Arabidopsis.2010 · DOI: 10.1073/pnas.0913810107
`At3g51470`	Probable protein phosphatase 2C 47.	No verified direct reference in this release
`At3g62260`	Probable protein phosphatase 2C 49.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os01g0552300`	Probable protein phosphatase 2C 5.	No verified direct reference in this release
`Os02g0799000`	Probable protein phosphatase 2C 27.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_011815 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006470 protein dephosphorylation Biological Process

GO:0006499 N-terminal protein myristoylation Biological Process

GO:0007165 signal transduction Biological Process

GO:0009767 photosynthetic electron transport chain Biological Process

GO:0016311 dephosphorylation Biological Process

GO:0032688 negative regulation of interferon-beta production Biological Process

GO:0035970 peptidyl-threonine dephosphorylation Biological Process

GO:0043122 regulation of canonical NF-kappaB signal transduction Biological Process

GO:0043124 negative regulation of canonical NF-kappaB signal transduction Biological Process

GO:0050687 negative regulation of defense response to virus Biological Process

GO:0080005 photosystem stoichiometry adjustment Biological Process

GO:0090263 positive regulation of canonical Wnt signaling pathway Biological Process

KEGG gene cross-reference

ath:AT3G51470

ath:AT4G27800

cel:CELE_T23F11.1

dosa:Os01g0552300

mmu:19043

osa:4325851

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Plastid0.936

Rank 1 · TkA02G611640 · TK1151

Mitochondrion0.055

Rank 2 · TkA02G611640 · TK1151

Cytoplasm0.034

Rank 3 · TkA02G611640 · TK1151

Nucleus0.032

Rank 4 · TkA02G611640 · TK1151

Peroxisome0.024

Rank 5 · TkA02G611640 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00481PP2C69-349 aa

PF13672PP2C_280-338 aa

PF10863NOP19139-170 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G611640	`PF00481`	PP2C	69	349	7e-53	180.6
TkA02G611640	`PF13672`	PP2C_2	80	338	4e-06	27.3
TkA02G611640	`PF10863`	NOP19	139	170	0.18	12.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`P49599`	Arabidopsis thaliana	sp\|P49599\|P2C57_ARATH Protein phosphatase 2C 57	65.400%	Swiss-Prot	High
`Q9SD02`	Arabidopsis thaliana	sp\|Q9SD02\|P2C47_ARATH Probable protein phosphatase 2C 47	31.300%	Swiss-Prot	Medium
`Q3EAF9`	Arabidopsis thaliana	sp\|Q3EAF9\|P2C49_ARATH Probable protein phosphatase 2C 49	30.600%	Swiss-Prot	Medium
`Q5JKN1`	Oryza sativa subsp. japonica	sp\|Q5JKN1\|P2C05_ORYSJ Probable protein phosphatase 2C 5	61.900%	Swiss-Prot	High
`Q69QZ0`	Oryza sativa subsp. japonica	sp\|Q69QZ0\|P2C27_ORYSJ Probable protein phosphatase 2C 27	28.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card