RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G607700
Reference: TK1151 Chr: Chr02 Coordinates: 156765423-156770108 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

3770 bp · TkA02G607700|TK1151|cDNA

AAATAGGCCTCTAACTTTGTCACTTAATCCTTTTTAACATGCATCAATCCTACAAATAGGCCTCTAATTTTGTCACTTAATCCTTTTTTAACATGCAGCAATCTAGAATTTTTTATTGTGCATGAGACTTGTACGTACAGTTACTTCAACACCATCACCTTAATCACACACATGCATGCACACTTGGACCAACCATGCACTCGACCAGTCTTCATGCAAAAGAGTCTCAGACCGGTAAACTGTCAACCAATAGGTAAGAC...

CDS

Download CDS FASTA

2604 bp · TkA02G607700|TK1151|CDS

ATGGCTTATTTTTGCTCTACCACTTGGGGTTTGTTCTTCATTGTTTTGCTAGAGGCCGTTGTGTGTATATCAGGCCGGGTCGGTTTGGGATCAAGATTGTATGCTAACGGCAATCGGATATGGGAATCTGCTAATCGTACATTTGGATTTGGGTTTGCTCAAGCTTTAGACGACGATTCAGGTCCACAAGACGGTCAATACAAGTTGGGAATTTGGTTCACCAATCTTCCAGGAGACCGCACGCTTGCTTGGTCCGCATA...

Protein

Download Protein FASTA

867 aa · TkA02G607700|TK1151|PROTEIN

MAYFCSTTWGLFFIVLLEAVVCISGRVGLGSRLYANGNRIWESANRTFGFGFAQALDDDSGPQDGQYKLGIWFTNLPGDRTLAWSAYLNAPVTKNAILELDTTGNLVLSDGRTTAWTSNTTNAGVESAELLDNGNLVLYTNNQEIAWQSFSHPSDTLLPGQPLTISVELTSSRIPTRGGGYYTLKILQQPTSLSLALTYNLPADPYNLSMEAQSNYSYWATPEFSNVTGDVLAVLGQAGSFGVVYGGDSSGAVYVYKNDN...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G607700
TK1151 IDTkA02G607700
OH-1004 IDLXL04_011856
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)98.500
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G607700
LocationChr02:156765423-156770108 (+)
DescriptionSimilar to At5g24080: G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g24080 G-type lectin S-receptor-like serine/threonine-protein kinase At5g24080. No verified direct reference in this release
At2g19130 G-type lectin S-receptor-like serine/threonine-protein kinase At2g19130. No verified direct reference in this release
At4g32300 G-type lectin S-receptor-like serine/threonine-protein kinase SD2-5. No verified direct reference in this release
At1g34300 G-type lectin S-receptor-like serine/threonine-protein kinase At1g34300. No verified direct reference in this release
At4g00340 Serine/threonine-protein kinase. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_011856 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006468 protein phosphorylation Biological Process
GO:0046777 protein autophosphorylation Biological Process
GO:0048544 recognition of pollen Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005634 nucleus Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0016020 membrane Cellular Component
GO:0004672 protein kinase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005516 calmodulin binding Molecular Function
GO:0005524 ATP binding Molecular Function
GO:0030246 carbohydrate binding Molecular Function
KEGG gene cross-reference
ath:AT1G34300
ath:AT2G19130
ath:AT4G00340
ath:AT4G32300
ath:AT5G24080
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.861
Rank 1 · TkA02G607700 · TK1151
Endoplasmic reticulum0.081
Rank 2 · TkA02G607700 · TK1151
Cytoplasm0.070
Rank 3 · TkA02G607700 · TK1151
Nucleus0.043
Rank 4 · TkA02G607700 · TK1151
Lysosome / Vacuole0.029
Rank 5 · TkA02G607700 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01453B_lectin81-168 aa
PF01453B_lectin207-243 aa
PF01453B_lectin251-316 aa
PF00954S_locus_glycop259-342 aa
PF08276PAN_2400-431 aa
PF00069Pkinase534-801 aa
PF07714PK_Tyr_Ser-Thr534-803 aa
PF03109ABC1537-561 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G607700PF01453B_lectin811682.1e-1970.6
TkA02G607700PF01453B_lectin2072432.1e-1970.6
TkA02G607700PF01453B_lectin2513162.1e-1970.6
TkA02G607700PF00954S_locus_glycop2593421.8e-0938.8
TkA02G607700PF08276PAN_24004310.008516.9
TkA02G607700PF00069Pkinase5348015.4e-45154.5
TkA02G607700PF07714PK_Tyr_Ser-Thr5348032.1e-41142.7
TkA02G607700PF03109ABC15375610.002617.7
TkA02G607700PF01636APH5816810.05214.0
TkA02G607700PF14531Kinase-like6227100.2611.2
TkA02G607700PF03109ABC16406890.002617.7
TkA02G607700PF05445Pox_ser-thr_kin6476700.3810.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9FLV4Arabidopsis thalianasp|Q9FLV4|Y5248_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g2408063.900%Swiss-ProtHigh
O64477Arabidopsis thalianasp|O64477|Y2913_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At2g1913034.900%Swiss-ProtMedium
Q8RWZ5Arabidopsis thalianasp|Q8RWZ5|SD25_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD2-534.600%Swiss-ProtMedium
Q9XID3Arabidopsis thalianasp|Q9XID3|Y1343_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g3430035.700%Swiss-ProtMedium
Q39203Arabidopsis thalianasp|Q39203|SD22_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD2-233.900%Swiss-ProtMedium

JBrowse

View in Genome Browser