TkA02G605760 | RubberDandelionOmics

Gene overview

TkA02G605760

Reference: TK1151 Chr: Chr02 Coordinates: 156273902-156275954 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1109 bp · TkA02G605760|TK1151|cDNA

CGGTGCACCCACCTGGAAAGCCTCCACGCCCCTTTCCTTCCTTCCTTACATCATCGACCAATTGCCTAATTCTCATCGGAAAACCACTACAAATTTGATAGCGGTACTTATCGTGAAGGATCGGATGATTAAAACGAAGAAGAAGAATAGTTAGGTCAGAGAAACAGCGTCAGCTTCTCCGTCTTCGTCCGTCCGCATCTCCTCTTCCTCTCTATCGGCGATTCCAAGCAACTTCATCCATCTCCGTCGACGACGACCCG...

CDS

Download CDS FASTA

417 bp · TkA02G605760|TK1151|CDS

ATGAAATCAATATCCAACCTCAAGTTCACTGAACCAACACCAATACAAAAAGCTTGCATACCTGCAGGTGCTCATCAAGGAAAGGATGTGATTGGTGCTGCTGAGACAGGATCCGGTAAAACACTAGCATTTGGATTACCAATTTTACAACGCCTTCTTGAAGAACGCGATAAATCTGAAAGACAGTTGGAGGAAAAAGGACAGGTTACTGATCATTTGAAGCAAGTGGCGAAAGGGACTGATGTTAGAGTTGTTCCAAT...

Protein

Download Protein FASTA

138 aa · TkA02G605760|TK1151|PROTEIN

MKSISNLKFTEPTPIQKACIPAGAHQGKDVIGAAETGSGKTLAFGLPILQRLLEERDKSERQLEEKGQVTDHLKQVAKGTDVRVVPIVGGMSTEKQERLLRTGRLWELMSGGEVHLVELHSLSFFVLDEADRMIDNGH

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G605760`
TK1151 ID	TkA02G605760
OH-1004 ID	LXL04_014601
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	79.700
Protein coverage (%)	TK1151 100.000 / OH-1004 20.925 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G605760

Location Chr02:156273902-156275954 (+)

Description Similar to Os04g0510400: DEAD-box ATP-dependent RNA helicase 13

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g16840`	DEAD-box ATP-dependent RNA helicase 13.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2XVF7`	DEAD-box ATP-dependent RNA helicase 13.	No verified direct reference in this release
`Os04g0510400`	DEAD-box ATP-dependent RNA helicase 13.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_014601 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006364 rRNA processing Biological Process

GO:0009409 response to cold Biological Process

GO:0031425 chloroplast RNA processing Biological Process

GO:0005634 nucleus Cellular Component

GO:0005730 nucleolus Cellular Component

GO:0003723 RNA binding Molecular Function

GO:0003724 RNA helicase activity Molecular Function

GO:0005524 ATP binding Molecular Function

GO:0016887 ATP hydrolysis activity Molecular Function

KEGG gene cross-reference

ath:AT3G16840

cnb:CNBL0260

ddi:DDB_G0281841

dosa:Os04g0510400

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.390

Rank 1 · TkA02G605760 · TK1151

Cytoplasm0.383

Rank 2 · TkA02G605760 · TK1151

Extracellular0.109

Rank 3 · TkA02G605760 · TK1151

Endoplasmic reticulum0.079

Rank 4 · TkA02G605760 · TK1151

Mitochondrion0.053

Rank 5 · TkA02G605760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00270DEAD13-137 aa

PF13401AAA_2234-133 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G605760	`PF00270`	DEAD	13	137	1.4e-20	74.4
TkA02G605760	`PF13401`	AAA_22	34	133	0.014	16.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y39`	Arabidopsis thaliana	sp\|Q93Y39\|RH13_ARATH DEAD-box ATP-dependent RNA helicase 13	58.700%	Swiss-Prot	High
`A2XVF7`	Oryza sativa subsp. indica	sp\|A2XVF7\|RH13_ORYSI DEAD-box ATP-dependent RNA helicase 13	58.800%	Swiss-Prot	High
`A3AVH5`	Oryza sativa subsp. japonica	sp\|A3AVH5\|RH13_ORYSJ DEAD-box ATP-dependent RNA helicase 13	58.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card