TkA02G587060 | RubberDandelionOmics

Gene overview

TkA02G587060

Reference: TK1151 Chr: Chr02 Coordinates: 151469443-151473078 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

648 bp · TkA02G587060|TK1151|cDNA

ATGCCAGGGATACCGTGGTCTCATAGATACGATGGTGAACCAACCAAGCAAAACCGCGTAACATCATTGGGTATGTCAAAACTTCTTGGTTATGAGGGACTTGAAGTTGTTAACCCTGAGGGAGGCATTGATGATGCTGAAGTTGAAGCACAAATAGGCAGATGGAAAGGAGAGGAGCGTAATAGTTACTGGAGGTCAATGCAGATGTATGTGGGTGCTGACATCACATCAATGGTGAGTTTACCAGTACTCATTTTTGA...

CDS

Download CDS FASTA

648 bp · TkA02G587060|TK1151|CDS

ATGCCAGGGATACCGTGGTCTCATAGATACGATGGTGAACCAACCAAGCAAAACCGCGTAACATCATTGGGTATGTCAAAACTTCTTGGTTATGAGGGACTTGAAGTTGTTAACCCTGAGGGAGGCATTGATGATGCTGAAGTTGAAGCACAAATAGGCAGATGGAAAGGAGAGGAGCGTAATAGTTACTGGAGGTCAATGCAGATGTATGTGGGTGCTGACATCACATCAATGGTGAGTTTACCAGTACTCATTTTTGA...

Protein

Download Protein FASTA

215 aa · TkA02G587060|TK1151|PROTEIN

MPGIPWSHRYDGEPTKQNRVTSLGMSKLLGYEGLEVVNPEGGIDDAEVEAQIGRWKGEERNSYWRSMQMYVGADITSMVSLPVLIFEPMKMLQKMAELMEYAHLLEQADNCEDPYMRLVCRASWFISVYYALQRTWKPFNPILGETYKMINHNGITFIAEQVLTSKVKTKFLGNTNDVYPLGRPRLKLKKDGVILEQVPPPTKVNNLIFGRTWID

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G587060`
TK1151 ID	TkA02G587060
OH-1004 ID	LXL04_036274
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	93.100
Protein coverage (%)	TK1151 80.930 / OH-1004 56.678 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G587060

Location Chr02:151469443-151473078 (-)

Description Similar to ORP3C: Oxysterol-binding protein-related protein 3C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59420`	May be involved in the transport of sterols.	No verified direct reference in this release
`At5g02100`	Oxysterol-binding protein that may be involved in the transport of sterols between the ER and the Golgi.	The targeting of the oxysterol-binding protein ORP3a to the endoplasmic reticulum relies on the plant VAP33 homolog PVA12.2009 · DOI: 10.1111/j.1365-313x.2009.03815.x
`At3g09300`	May be involved in the transport of sterols.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036274 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0015914 phospholipid transport Biological Process

GO:0050830 defense response to Gram-positive bacterium Biological Process

GO:0120009 intermembrane lipid transfer Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT3G09300

ath:AT5G02100

ath:AT5G59420

ddi:DDB_G0283709

ddi:DDB_G0288817

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.390

Rank 1 · TkA02G587060 · TK1151

Cytoplasm0.222

Rank 2 · TkA02G587060 · TK1151

Cell membrane0.145

Rank 3 · TkA02G587060 · TK1151

Golgi apparatus0.122

Rank 4 · TkA02G587060 · TK1151

Nucleus0.097

Rank 5 · TkA02G587060 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01237Oxysterol_BP62-162 aa

PF21861RepB_C95-130 aa

PF28356DNAJC15_N130-150 aa

PF21861RepB_C147-156 aa

PF28356DNAJC15_N160-168 aa

PF01237Oxysterol_BP164-215 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G587060	`PF01237`	Oxysterol_BP	62	162	2.6e-38	132.6
TkA02G587060	`PF21861`	RepB_C	95	130	0.37	11.5
TkA02G587060	`PF28356`	DNAJC15_N	130	150	0.12	12.5
TkA02G587060	`PF21861`	RepB_C	147	156	0.37	11.5
TkA02G587060	`PF28356`	DNAJC15_N	160	168	0.12	12.5
TkA02G587060	`PF01237`	Oxysterol_BP	164	215	2.6e-38	132.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y40`	Arabidopsis thaliana	sp\|Q93Y40\|ORP3C_ARATH Oxysterol-binding protein-related protein 3C	65.300%	Swiss-Prot	High
`Q9LZM1`	Arabidopsis thaliana	sp\|Q9LZM1\|ORP3A_ARATH Oxysterol-binding protein-related protein 3A	65.700%	Swiss-Prot	High
`Q9SR33`	Arabidopsis thaliana	sp\|Q9SR33\|ORP3B_ARATH Oxysterol-binding protein-related protein 3B	63.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card