LXL04_036274 | RubberDandelionOmics

Gene overview

LXL04_036274

Reference: OH-1004 Chr: Chr08 Coordinates: 39150813-39153761 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

924 bp · LXL04_036274|LXL04_036274|OH1004|cDNA

ATGTTTGAATTTACAAGGGTAAACACTAAGGACGATCACGAAGGGGACATCGAACAGGGAAATCTCTATCCTGGGATTAGCCATGGAGAAAATCAAATTCGTTGGGGCTTCATCCGTAAGGTTTACGGCATTCTCGCCGCCCAGATGGTTTTGACCACATCGGTCTCTTGCCTCACTGTCCTATACGCACATATCAACGATCTTCTTCGTGGGAATTCCGGCCGCTTGCCCTTCATCCACTTCTTGGTTATGAGGGACTT...

CDS

Download CDS FASTA

924 bp · LXL04_036274|LXL04_036274|OH1004|CDS

ATGTTTGAATTTACAAGGGTAAACACTAAGGACGATCACGAAGGGGACATCGAACAGGGAAATCTCTATCCTGGGATTAGCCATGGAGAAAATCAAATTCGTTGGGGCTTCATCCGTAAGGTTTACGGCATTCTCGCCGCCCAGATGGTTTTGACCACATCGGTCTCTTGCCTCACTGTCCTATACGCACATATCAACGATCTTCTTCGTGGGAATTCCGGCCGCTTGCCCTTCATCCACTTCTTGGTTATGAGGGACTT...

Protein

Download Protein FASTA

307 aa · LXL04_036274|LXL04_036274|OH1004|PROTEIN

MFEFTRVNTKDDHEGDIEQGNLYPGISHGENQIRWGFIRKVYGILAAQMVLTTSVSCLTVLYAHINDLLRGNSGRLPFIHFLVMRDLKLFTLRGTDDAEVEAQRGRWKGEERDSYWRSMQKYVGADITSMVTLQVLIFEPMKMLQKMAELMEYAHLLEQADDCEDPYMRLVCRASWFISVYYALQRTWKPFNPILGETYEMINHNGITFTAEQVVTSKVKTKFLGNTNDVYPLGRTRLKLKKDGVILELVPPPTKVNNLI...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_036274`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_036274

Location Chr08:39150813-39153761 (-)

Description Similar to ORP3C: Oxysterol-binding protein-related protein 3C

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g59420`	May be involved in the transport of sterols.	No verified direct reference in this release
`At5g02100`	Oxysterol-binding protein that may be involved in the transport of sterols between the ER and the Golgi.	The targeting of the oxysterol-binding protein ORP3a to the endoplasmic reticulum relies on the plant VAP33 homolog PVA12.2009 · DOI: 10.1111/j.1365-313x.2009.03815.x
`At3g09300`	May be involved in the transport of sterols.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_036274 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006869 lipid transport Biological Process

GO:0009567 double fertilization forming a zygote and endosperm Biological Process

GO:0015914 phospholipid transport Biological Process

GO:0050830 defense response to Gram-positive bacterium Biological Process

GO:0120009 intermembrane lipid transfer Biological Process

GO:0005634 nucleus Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005794 Golgi apparatus Cellular Component

GO:0005829 cytosol Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0009536 plastid Cellular Component

KEGG gene cross-reference

ath:AT3G09300

ath:AT5G02100

ath:AT5G59420

ddi:DDB_G0283709

ddi:DDB_G0288817

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.560

Rank 1 · LXL04_036274 · OH-1004

Golgi apparatus0.182

Rank 2 · LXL04_036274 · OH-1004

Cytoplasm0.163

Rank 3 · LXL04_036274 · OH-1004

Cell membrane0.151

Rank 4 · LXL04_036274 · OH-1004

Nucleus0.116

Rank 5 · LXL04_036274 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF01237.24Oxysterol_BP114-215 aa

PF01237.24Oxysterol_BP216-285 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_036274	`PF01237.24`	Oxysterol_BP	114	215	8.2e-43	147.4
LXL04_036274	`PF01237.24`	Oxysterol_BP	216	285	8.2e-43	147.4

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93Y40`	Arabidopsis thaliana	Oxysterol-binding protein-related protein 3C	69.194%	Swiss-Prot	moderate database homology
`Q9LZM1`	Arabidopsis thaliana	Oxysterol-binding protein-related protein 3A	69.524%	Swiss-Prot	moderate database homology
`Q9SR33`	Arabidopsis thaliana	Oxysterol-binding protein-related protein 3B	66.667%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card