TkA02G578980 | RubberDandelionOmics

Gene overview

TkA02G578980

Reference: TK1151 Chr: Chr02 Coordinates: 149360551-149362721 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1947 bp · TkA02G578980|TK1151|cDNA

ATGCTACAAGGTACCATCCACCTCAACACCTCCCTCTTTGATCTTCCGCATCTCCAAAGACTCAACCTTGCTTACAATAACTTTAATGCTTCCCAACTTCCACGTGAAATTGGTAAGTTTTCTAAAAGTCTCACACATCTCAACATCTCTTCATGTGGGTGTACTGGCGATATTCCTAGGGAGATATTATTTCTCCCTAAATTGGTTTCTCTCGATCTCTCTTCGAATCATGGATTGCAAATGCATCCTTATATTTTAAA...

CDS

Download CDS FASTA

1947 bp · TkA02G578980|TK1151|CDS

ATGCTACAAGGTACCATCCACCTCAACACCTCCCTCTTTGATCTTCCGCATCTCCAAAGACTCAACCTTGCTTACAATAACTTTAATGCTTCCCAACTTCCACGTGAAATTGGTAAGTTTTCTAAAAGTCTCACACATCTCAACATCTCTTCATGTGGGTGTACTGGCGATATTCCTAGGGAGATATTATTTCTCCCTAAATTGGTTTCTCTCGATCTCTCTTCGAATCATGGATTGCAAATGCATCCTTATATTTTAAA...

Protein

Download Protein FASTA

648 aa · TkA02G578980|TK1151|PROTEIN

MLQGTIHLNTSLFDLPHLQRLNLAYNNFNASQLPREIGKFSKSLTHLNISSCGCTGDIPREILFLPKLVSLDLSSNHGLQMHPYILKNLQQKSTHLREVDITSADIGWVLPIYLNISSSIKSLNLGWTGLQGKLPENMFNLPNLENLDLSANWLLTGPLPKINKSINIPLNSLDLSECGLFGPFPKSLYNRTHLTYLSLEGNMLNGSLPSLLFTLPSIEQINIGFNLFSGGLPLELFKCRSLKVLLLRQNLLDGGVDQGF...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G578980`
TK1151 ID	TkA02G578980
OH-1004 ID	LXL04_012240
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	61.700
Protein coverage (%)	TK1151 90.586 / OH-1004 43.665 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G578980

Location Chr02:149360551-149362721 (+)

Description Similar to 9DC3: Receptor-like protein 9DC3

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g40170`	Receptor-like protein 54.	No verified direct reference in this release
`At2g32660`	Receptor like protein 22.	No verified direct reference in this release
`At2g33080`	Receptor like protein 28.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012240 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0002238 response to molecule of fungal origin Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ag:AAA65235

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.851

Rank 1 · TkA02G578980 · TK1151

Endoplasmic reticulum0.099

Rank 2 · TkA02G578980 · TK1151

Cytoplasm0.062

Rank 3 · TkA02G578980 · TK1151

Nucleus0.055

Rank 4 · TkA02G578980 · TK1151

Extracellular0.025

Rank 5 · TkA02G578980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF27089PRAME_C8-89 aa

PF13855LRR_810-51 aa

PF23286LRR_1310-60 aa

PF23598LRR_1411-90 aa

PF12799LRR_413-28 aa

PF24048LRR_NXF1-515-48 aa

PF13855LRR_816-77 aa

PF13516LRR_616-29 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G578980	`PF27089`	PRAME_C	8	89	0.098	12.4
TkA02G578980	`PF13855`	LRR_8	10	51	1.6e-42	143.8
TkA02G578980	`PF23286`	LRR_13	10	60	0.0024	18.3
TkA02G578980	`PF23598`	LRR_14	11	90	4.6e-19	69.1
TkA02G578980	`PF12799`	LRR_4	13	28	5.9e-29	100.1
TkA02G578980	`PF24048`	LRR_NXF1-5	15	48	2.7	8.3
TkA02G578980	`PF13855`	LRR_8	16	77	1.6e-42	143.8
TkA02G578980	`PF13516`	LRR_6	16	29	4.3e-13	48.9
TkA02G578980	`PF00560`	LRR_1	17	39	3.5e-41	131.0
TkA02G578980	`PF24758`	LRR_At5g56370	17	150	2e-08	34.9
TkA02G578980	`PF29594`	LRR_SKP2	17	219	5.4e-05	23.3
TkA02G578980	`PF13516`	LRR_6	41	53	4.3e-13	48.9
TkA02G578980	`PF12799`	LRR_4	42	76	5.9e-29	100.1
TkA02G578980	`PF29870`	YDR417C	42	61	0.18	12.6
TkA02G578980	`PF00560`	LRR_1	43	62	3.5e-41	131.0
TkA02G578980	`PF23286`	LRR_13	64	91	0.0024	18.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`F4KHA2`	Arabidopsis thaliana	sp\|F4KHA2\|RLP54_ARATH Receptor-like protein 54	31.600%	Swiss-Prot	Low
`O48851`	Arabidopsis thaliana	sp\|O48851\|RLP22_ARATH Receptor like protein 22	30.400%	Swiss-Prot	Low
`O49325`	Arabidopsis thaliana	sp\|O49325\|RLP28_ARATH Receptor like protein 28	32.500%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card