LXL04_012240 | RubberDandelionOmics

Gene overview

LXL04_012240

Reference: OH-1004 Chr: Chr03 Coordinates: 8944795-8953897 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

4365 bp · LXL04_012240|LXL04_012240|OH1004|cDNA

ATGAATTTGAGTTCATCTATTCGATATACTATATTTTTAACAGGTGTAATTGGTCATAgcaaattcaaaaaaaaaaaaaaaaaaatggatAGTTCAAAGTTGCTTCTCTGCTTTTcccttttctttttctttatgTGTTTTGCTGCTTCCTCTTCTTTCAATACCACTAAAAAATGCTCTCATCAACAAACCCTTGCGTTGCTTTTATTTAAACAAAACCTCACTTCCATACATTCCCCAGATGATGATCCACAACATAA...

CDS

Download CDS FASTA

4194 bp · LXL04_012240|LXL04_012240|OH1004|CDS

ATGAATTTGAGTTCATCTATTCGATATACTATATTTTTAACAGGTGTAATTGGTCATAGCAAATTCAAAAAAAAAAAAAAAAAAATGGATAGTTCAAAGTTGCTTCTCTGCTTTTCCCTTTTCTTTTTCTTTATGTGTTTTGCTGCTTCCTCTTCTTTCAATACCACTAAAAAATGCTCTCATCAACAAACCCTTGCGTTGCTTTTATTTAAACAAAACCTCACTTCCATACATTCCCCAGATGATGATCCACAACATAA...

Protein

Download Protein FASTA

1397 aa · LXL04_012240|LXL04_012240|OH1004|PROTEIN

MNLSSSIRYTIFLTGVIGHSKFKKKKKKMDSSKLLLCFSLFFFFMCFAASSSFNTTKKCSHQQTLALLLFKQNLTSIHSPDDDPQHNSACQNLLSSDYHPIMMNWSMGTDCCKWDGITCNHLTGDVIGIDLSCGMLQGTIHPNTTLFHIPRLQTLNLAYNDFTDSQLPRDIGKSSNSLTHLNISSCGLSGDIPSEIVFLSKLVSLDLSSNQGLKMHPYVLENMLRNSSHLREVVMAHVDIGWVLPTSLNISSSLKSLDLS...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012240`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`LXL04_012240`
Location	Chr03:8944795-8953897 (-)
Description	Similar to 9DC3: Receptor-like protein 9DC3
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012240` · GCA_047496595.1_OSU_TarKok_2.0.
GO annotations (OH1004 source)	GO:0002238 response to molecule of fungal origin Biological Process GO:0050832 defense response to fungus Biological Process GO:0005886 plasma membrane Cellular Component
KEGG gene cross-reference	ag:AAA65235 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.825

Rank 1 · LXL04_012240 · OH-1004

Endoplasmic reticulum0.100

Rank 2 · LXL04_012240 · OH-1004

Cytoplasm0.071

Rank 3 · LXL04_012240 · OH-1004

Nucleus0.044

Rank 4 · LXL04_012240 · OH-1004

Extracellular0.043

Rank 5 · LXL04_012240 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13855.13LRR_8483-538 aa

PF13855.13LRR_8504-562 aa

PF13855.13LRR_8528-587 aa

PF13855.13LRR_8576-635 aa

PF12799.14LRR_4576-611 aa

PF13855.13LRR_8600-661 aa

PF13855.13LRR_8720-776 aa

PF13855.13LRR_81005-1067 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012240	`PF13855.13`	LRR_8	483	538	4.1e-57	190.5
LXL04_012240	`PF13855.13`	LRR_8	504	562	4.1e-57	190.5
LXL04_012240	`PF13855.13`	LRR_8	528	587	4.1e-57	190.5
LXL04_012240	`PF13855.13`	LRR_8	576	635	4.1e-57	190.5
LXL04_012240	`PF12799.14`	LRR_4	576	611	9.5e-44	147.2
LXL04_012240	`PF13855.13`	LRR_8	600	661	4.1e-57	190.5
LXL04_012240	`PF13855.13`	LRR_8	720	776	4.1e-57	190.5
LXL04_012240	`PF13855.13`	LRR_8	1005	1067	4.1e-57	190.5
LXL04_012240	`PF13855.13`	LRR_8	1153	1212	4.1e-57	190.5
LXL04_012240	`PF13855.13`	LRR_8	1229	1284	4.1e-57	190.5
LXL04_012240	`PF12799.14`	LRR_4	1248	1282	9.5e-44	147.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card