RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G567600
Reference: TK1151 Chr: Chr02 Coordinates: 146642523-146644456 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

1611 bp · TkA02G567600|TK1151|cDNA

ATGCTGATAATTATGGCGGTTTTACTGGTCGGCGCCGCTAGGGCGGCGGCCATCCCCTGCCCAGATTGCGGGAAAATTCCAGTCCTGTATCCACTCAGTACAACACCAACGTGTGGCCATCAATCATACAAGATTCGGTGCGATAGGGGTTTGTTGAAATTCGATTCCATCAATAACACTTACCCGATCATCTCAATCTTCCCCAAAAATCAACGCATGGTAATCGGTCAATCGCATCTATTACCAAACACCTGCGTCAT...

CDS

Download CDS FASTA

1611 bp · TkA02G567600|TK1151|CDS

ATGCTGATAATTATGGCGGTTTTACTGGTCGGCGCCGCTAGGGCGGCGGCCATCCCCTGCCCAGATTGCGGGAAAATTCCAGTCCTGTATCCACTCAGTACAACACCAACGTGTGGCCATCAATCATACAAGATTCGGTGCGATAGGGGTTTGTTGAAATTCGATTCCATCAATAACACTTACCCGATCATCTCAATCTTCCCCAAAAATCAACGCATGGTAATCGGTCAATCGCATCTATTACCAAACACCTGCGTCAT...

Protein

Download Protein FASTA

536 aa · TkA02G567600|TK1151|PROTEIN

MLIIMAVLLVGAARAAAIPCPDCGKIPVLYPLSTTPTCGHQSYKIRCDRGLLKFDSINNTYPIISIFPKNQRMVIGQSHLLPNTCVMADFVTMAYSSFVNLNISLPISKWPDPGVELIWAPPPEPPCTSQGHCDSTSTCRDDHDGTRRCFCNPKFRWDANTGQCAKDLKKARAKRKSLLAITICIGVIIFLTVVFAITMFIRRQRIKRARKRRSRERQEIVGSTSGTGRSSRIFSNKEIKKATNNFSSTGLLGVGGFGEV...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G567600
TK1151 IDTkA02G567600
OH-1004 IDLXL04_012391
Relationship / confidenceMulti Source To Oh1004 / Complex relationship
Protein identity (%)85.000
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G567600
LocationChr02:146642523-146644456 (-)
DescriptionSimilar to WAKL20: Wall-associated receptor kinase-like 20
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g02070 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At3g53840 Putative serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At5g66790 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g69730 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release
At1g79680 Serine/threonine-protein kinase that may function as a signaling receptor of extracellular matrix component. No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012391 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0006952 defense response Biological Process
GO:0007166 cell surface receptor signaling pathway Biological Process
GO:0009617 response to bacterium Biological Process
GO:0009620 response to fungus Biological Process
GO:0009751 response to salicylic acid Biological Process
GO:0005576 extracellular region Cellular Component
GO:0005886 plasma membrane Cellular Component
GO:0009507 chloroplast Cellular Component
GO:0004383 guanylate cyclase activity Molecular Function
GO:0004674 protein serine/threonine kinase activity Molecular Function
GO:0005509 calcium ion binding Molecular Function
GO:0005524 ATP binding Molecular Function
KEGG gene cross-reference
ath:AT1G69730
ath:AT1G79680
ath:AT3G53840
ath:AT5G02070
ath:AT5G66790
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.874
Rank 1 · TkA02G567600 · TK1151
Cytoplasm0.087
Rank 2 · TkA02G567600 · TK1151
Endoplasmic reticulum0.070
Rank 3 · TkA02G567600 · TK1151
Nucleus0.054
Rank 4 · TkA02G567600 · TK1151
Lysosome / Vacuole0.022
Rank 5 · TkA02G567600 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13947GUB_WAK_bind20-75 aa
PF01683EB123-164 aa
PF12946EGF_MSP1_1127-161 aa
PF12947EGF_3129-158 aa
PF25387ADGRF3_N136-162 aa
PF17204Sid-5163-212 aa
PF27960NCMAP182-219 aa
PF13314DUF4083182-211 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G567600PF13947GUB_WAK_bind20751.3e-0629.4
TkA02G567600PF01683EB1231640.2112.4
TkA02G567600PF12946EGF_MSP1_11271610.03614.8
TkA02G567600PF12947EGF_31291584.58.3
TkA02G567600PF25387ADGRF3_N1361620.006617.6
TkA02G567600PF17204Sid-51632120.001819.1
TkA02G567600PF27960NCMAP1822190.02315.3
TkA02G567600PF13314DUF40831822110.03614.8
TkA02G567600PF14575EphA2_TM1822150.2712.7
TkA02G567600PF00069Pkinase2495154.7e-44151.5
TkA02G567600PF07714PK_Tyr_Ser-Thr2515172.2e-47162.3
TkA02G567600PF03109ABC12523001.2e-0525.4
TkA02G567600PF12330Haspin_kinase3403980.06413.0
TkA02G567600PF03109ABC13443971.2e-0525.4
TkA02G567600PF25387ADGRF3_N4154230.006617.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q9LZM4Arabidopsis thalianasp|Q9LZM4|WAKLQ_ARATH Wall-associated receptor kinase-like 2051.100%Swiss-ProtHigh
Q9M342Arabidopsis thalianasp|Q9M342|WAKLP_ARATH Wall-associated receptor kinase-like 1552.500%Swiss-ProtHigh
Q8GYF5Arabidopsis thalianasp|Q8GYF5|WAKLR_ARATH Wall-associated receptor kinase-like 2140.500%Swiss-ProtMedium
Q9C9L5Arabidopsis thalianasp|Q9C9L5|WAKLH_ARATH Wall-associated receptor kinase-like 948.500%Swiss-ProtMedium
Q8VYA3Arabidopsis thalianasp|Q8VYA3|WAKLJ_ARATH Wall-associated receptor kinase-like 1047.700%Swiss-ProtMedium

JBrowse

View in Genome Browser