TkA02G565930 | RubberDandelionOmics

Gene overview

TkA02G565930

Reference: TK1151 Chr: Chr02 Coordinates: 146099300-146099704 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

405 bp · TkA02G565930|TK1151|cDNA

ATGGAAGACAACTCAGTGACACTCAAATTGATCTCCCTTTTGGTCATCGTTTCATTCGTAGCCATCTTAGTCGCCATCTACCACTTTGTCACTGTTAGTTGGTGCTATCGTCGGCGAAATAATTTCCCACCACACCATGTGCACCAACAAAATCATCATCTGGATCATACCGACTACAGTCTGGAGAATTCAGTGGTGTTGCTCATCCCGGCCCACAAGCACCAAAAAGGGTCGAAAGTAGGTACAAAAGAATGCGATGA...

CDS

Download CDS FASTA

405 bp · TkA02G565930|TK1151|CDS

ATGGAAGACAACTCAGTGACACTCAAATTGATCTCCCTTTTGGTCATCGTTTCATTCGTAGCCATCTTAGTCGCCATCTACCACTTTGTCACTGTTAGTTGGTGCTATCGTCGGCGAAATAATTTCCCACCACACCATGTGCACCAACAAAATCATCATCTGGATCATACCGACTACAGTCTGGAGAATTCAGTGGTGTTGCTCATCCCGGCCCACAAGCACCAAAAAGGGTCGAAAGTAGGTACAAAAGAATGCGATGA...

Protein

Download Protein FASTA

134 aa · TkA02G565930|TK1151|PROTEIN

MEDNSVTLKLISLLVIVSFVAILVAIYHFVTVSWCYRRRNNFPPHHVHQQNHHLDHTDYSLENSVVLLIPAHKHQKGSKVGTKECDDDAMCSICLCEFEENEELRTLPECSHSFHVPCIDMWPFFSFYLSRVSC

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G565930`
TK1151 ID	TkA02G565930
OH-1004 ID	LXL04_012421
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.200
Protein coverage (%)	TK1151 92.537 / OH-1004 76.074 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G565930

Location Chr02:146099300-146099704 (+)

Description Similar to ATL51: RING-H2 finger protein ATL51

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g47560`	RING-H2 finger protein ATL64.	No verified direct reference in this release
`At1g23980`	RING-H2 finger protein ATL47.	No verified direct reference in this release
`At5g43420`	RING-H2 finger protein ATL16.	No verified direct reference in this release
`At4g17905`	Putative RING-H2 finger protein ATL53.	No verified direct reference in this release
`At4g09130`	Putative RING-H2 finger protein ATL37.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012421 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0016567 protein ubiquitination Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0016020 membrane Cellular Component

GO:0008270 zinc ion binding Molecular Function

GO:0061630 ubiquitin protein ligase activity Molecular Function

KEGG gene cross-reference

ath:AT1G23980

ath:AT3G03550

ath:AT4G17905

ath:AT4G40070

ath:AT5G17600

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.304

Rank 1 · TkA02G565930 · TK1151

Lysosome / Vacuole0.295

Rank 2 · TkA02G565930 · TK1151

Cell membrane0.236

Rank 3 · TkA02G565930 · TK1151

Cytoplasm0.202

Rank 4 · TkA02G565930 · TK1151

Nucleus0.161

Rank 5 · TkA02G565930 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF06024Orf787-32 aa

PF15706TMEM132_C14-46 aa

PF12678zf-rbx187-122 aa

PF13639zf-RING_290-122 aa

PF13923zf-C3HC4_290-121 aa

PF17123zf-RING_1191-119 aa

PF13445zf-RING_UBOX91-123 aa

PF14634zf-RING_591-120 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G565930	`PF06024`	Orf78	7	32	3.2	8.8
TkA02G565930	`PF15706`	TMEM132_C	14	46	0.24	11.9
TkA02G565930	`PF12678`	zf-rbx1	87	122	0.0025	18.7
TkA02G565930	`PF13639`	zf-RING_2	90	122	8.7e-09	36.2
TkA02G565930	`PF13923`	zf-C3HC4_2	90	121	0.012	16.2
TkA02G565930	`PF17123`	zf-RING_11	91	119	9.1e-11	42.0
TkA02G565930	`PF13445`	zf-RING_UBOX	91	123	0.00084	20.0
TkA02G565930	`PF14634`	zf-RING_5	91	120	0.0021	18.7
TkA02G565930	`PF00097`	zf-C3HC4	91	122	0.0022	18.5

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O22255`	Arabidopsis thaliana	sp\|O22255\|ATL64_ARATH RING-H2 finger protein ATL64	34.400%	Swiss-Prot	Medium
`Q8GW38`	Arabidopsis thaliana	sp\|Q8GW38\|ATL47_ARATH RING-H2 finger protein ATL47	43.200%	Swiss-Prot	Medium
`Q9LSW9`	Arabidopsis thaliana	sp\|Q9LSW9\|ATL16_ARATH RING-H2 finger protein ATL16	40.800%	Swiss-Prot	Low
`P0C041`	Arabidopsis thaliana	sp\|P0C041\|ATL53_ARATH Putative RING-H2 finger protein ATL53	41.700%	Swiss-Prot	Medium
`Q9M0R4`	Arabidopsis thaliana	sp\|Q9M0R4\|ATL37_ARATH Putative RING-H2 finger protein ATL37	42.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card