TkA02G563790 | RubberDandelionOmics

Gene overview

TkA02G563790

Reference: TK1151 Chr: Chr02 Coordinates: 145606953-145610590 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2192 bp · TkA02G563790|TK1151|cDNA

TAAGGATGCTACTAAATATACACCCTAAAAATGCTTGCTATACACCTTGTCAGAAAGTAAACTTATACTGTATCGAAGCCTGTGATATATTGAAACTTGTTACCTACTCCATTGAGTTATAAGGCAGTTTGACCATAACGCCAACGAACGGATGACCCTGACAGCACGATGAGGGGCATTTCAGTAATTAACATCCGGGGGTTGAAAAGCTGCAGCACGAGCGGAAATGGACGAATTAGCGACTTGGTTGAGTGTATTTC...

CDS

Download CDS FASTA

1686 bp · TkA02G563790|TK1151|CDS

ATGGAGGACTCATTGGAGAGGTTAGTATCGGAGCCATCGGAAATGAAGGATGAGCTGTCTATGGAAATCGATCCTCCGTTCAAGGAAAACCATGCGACCGCTGAGGATTGGAGAAAAGCGCTTCACAACGTCGTTCCGGCGGTGGTGGTGCTTCGTACGACTGCCTGCCGAGCTTTTGACACCGAGTCTGCCGGTGCTAGCTATGCTACAGGGTTTGTTGTTGATAAGCGCCGGGGAATTATACTAACTAATCGTCATGT...

Protein

Download Protein FASTA

562 aa · TkA02G563790|TK1151|PROTEIN

MEDSLERLVSEPSEMKDELSMEIDPPFKENHATAEDWRKALHNVVPAVVVLRTTACRAFDTESAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEATFVNREEIPIYPIYRDPVHDFGFFRYDPAAIQFLSYEEIPLAPEAACVGLEIRVVGNDSGEKISILAGTLARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWKGRAVALNAGSKTSSASAFFFPLERAVRALKFLQKGRDCGQDKWEAVSIPRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G563790`
TK1151 ID	TkA02G563790
OH-1004 ID	LXL04_006994
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.200
Protein coverage (%)	TK1151 99.644 / OH-1004 54.677 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G563790

Location Chr02:145606953-145610590 (+)

Description Similar to DEGP7: Protease Do-like 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03380`	Probable serine protease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006994 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0010205 photoinhibition Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0120174 stress-induced homeostatically regulated protein degradation pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004252 serine-type endopeptidase activity Molecular Function

GO:0008233 peptidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G03380

cim:CIMG_02828

pno:SNOG_03294

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.426

Rank 1 · TkA02G563790 · TK1151

Nucleus0.247

Rank 2 · TkA02G563790 · TK1151

Endoplasmic reticulum0.151

Rank 3 · TkA02G563790 · TK1151

Mitochondrion0.131

Rank 4 · TkA02G563790 · TK1151

Cell membrane0.105

Rank 5 · TkA02G563790 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF05579Peptidase_S3251-90 aa

PF00089Trypsin66-221 aa

PF10459Peptidase_S4667-88 aa

PF13365Trypsin_269-215 aa

PF10459Peptidase_S46195-229 aa

PF05579Peptidase_S32196-225 aa

PF00595PDZ276-334 aa

PF13180PDZ_2286-363 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G563790	`PF05579`	Peptidase_S32	51	90	0.16	11.8
TkA02G563790	`PF00089`	Trypsin	66	221	0.023	15.2
TkA02G563790	`PF10459`	Peptidase_S46	67	88	0.035	13.5
TkA02G563790	`PF13365`	Trypsin_2	69	215	5e-22	79.9
TkA02G563790	`PF10459`	Peptidase_S46	195	229	0.035	13.5
TkA02G563790	`PF05579`	Peptidase_S32	196	225	0.16	11.8
TkA02G563790	`PF00595`	PDZ	276	334	5.9e-06	27.3
TkA02G563790	`PF13180`	PDZ_2	286	363	5.5e-09	36.9
TkA02G563790	`PF17820`	PDZ_6	300	352	1.6e-07	31.6
TkA02G563790	`PF14685`	PDZ_Tricorn	314	355	0.26	12.2
TkA02G563790	`PF12812`	PDZ_1	368	441	2.3e-17	63.5
TkA02G563790	`PF17820`	PDZ_6	400	449	1.6e-07	31.6
TkA02G563790	`PF14685`	PDZ_Tricorn	415	463	0.26	12.2
TkA02G563790	`PF13180`	PDZ_2	419	452	5.5e-09	36.9
TkA02G563790	`PF13365`	Trypsin_2	461	516	5e-22	79.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY22`	Arabidopsis thaliana	sp\|Q8RY22\|DEGP7_ARATH Protease Do-like 7	68.800%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card