LXL04_006994 | RubberDandelionOmics

Gene overview

LXL04_006994

Reference: OH-1004 Chr: Chr02 Coordinates: 33059576-33064858 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

3114 bp · LXL04_006994|LXL04_006994|OH1004|cDNA

ATGGAGGACTCATTGGAGAGGTTAGTATCGGAGCCATCGGAAATGAAGGATGAGCTGTCTATGGAAATCGATCCTCCGTTCAAGGAAAACCATGCGACCGCTGAGGATTGGAGAAAAGCGCTTCACAACGTCGTTCCGGCGGTGGTGGTGCTTCGTACGACTGCCTGCCGAGCTTTTGACACCGAGTCTGCCGGTGCTAGCTATGCTACAGGGTTTGTTGTTGATAAACGCCGGGGAATTATACTAACTAATCGTCATGT...

CDS

Download CDS FASTA

3114 bp · LXL04_006994|LXL04_006994|OH1004|CDS

ATGGAGGACTCATTGGAGAGGTTAGTATCGGAGCCATCGGAAATGAAGGATGAGCTGTCTATGGAAATCGATCCTCCGTTCAAGGAAAACCATGCGACCGCTGAGGATTGGAGAAAAGCGCTTCACAACGTCGTTCCGGCGGTGGTGGTGCTTCGTACGACTGCCTGCCGAGCTTTTGACACCGAGTCTGCCGGTGCTAGCTATGCTACAGGGTTTGTTGTTGATAAACGCCGGGGAATTATACTAACTAATCGTCATGT...

Protein

Download Protein FASTA

1037 aa · LXL04_006994|LXL04_006994|OH1004|PROTEIN

MEDSLERLVSEPSEMKDELSMEIDPPFKENHATAEDWRKALHNVVPAVVVLRTTACRAFDTESAGASYATGFVVDKRRGIILTNRHVVKPGPVVAEATFVNREEIPIYPIYRDPVHDFGFFRYDPAAIQFLSYEEIPLAPEAACVGLEIRVVGNDSGEKISILAGTLARLDRDAPHYKKDGYNDFNTFYMQAASGTKGGSSGSPVIDWKGRAVALNAGSKTSSASAFFFPLERVVRALKFLQKGRDCGQDKWEAVSIPRG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_006994`
TK1151 ID	TkA02G563790
OH-1004 ID	LXL04_006994
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	97.200
Protein coverage (%)	TK1151 99.644 / OH-1004 54.677 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_006994

Location Chr02:33059576-33064858 (+)

Description Similar to DEGP7: Protease Do-like 7

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g03380`	Probable serine protease.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_006994 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0006508 proteolysis Biological Process

GO:0006629 lipid metabolic process Biological Process

GO:0010205 photoinhibition Biological Process

GO:0034605 cellular response to heat Biological Process

GO:0120174 stress-induced homeostatically regulated protein degradation pathway Biological Process

GO:0005634 nucleus Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004252 serine-type endopeptidase activity Molecular Function

GO:0008233 peptidase activity Molecular Function

KEGG gene cross-reference

ath:AT3G03380

cim:CIMG_02828

pno:SNOG_03294

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.450

Rank 1 · LXL04_006994 · OH-1004

Nucleus0.257

Rank 2 · LXL04_006994 · OH-1004

Endoplasmic reticulum0.128

Rank 3 · LXL04_006994 · OH-1004

Mitochondrion0.104

Rank 4 · LXL04_006994 · OH-1004

Cell membrane0.097

Rank 5 · LXL04_006994 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF13365.13Trypsin_269-215 aa

PF12812.14PDZ_1375-448 aa

PF13365.13Trypsin_2623-739 aa

PF12812.14PDZ_1912-988 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_006994	`PF13365.13`	Trypsin_2	69	215	2.4e-29	103.6
LXL04_006994	`PF12812.14`	PDZ_1	375	448	1.9e-29	102.2
LXL04_006994	`PF13365.13`	Trypsin_2	623	739	2.4e-29	103.6
LXL04_006994	`PF12812.14`	PDZ_1	912	988	1.9e-29	102.2

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q8RY22`	Arabidopsis thaliana	Protease Do-like 7	73.442%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card