TkA02G560760 | RubberDandelionOmics

Gene overview

TkA02G560760

Reference: TK1151 Chr: Chr02 Coordinates: 144832468-144835178 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1158 bp · TkA02G560760|TK1151|cDNA

ATGTGGGTGTATTACTCCCTACCCCCCACCCCACCCACCCCACCCCAAAACCCTCTGCAACTTGTAAGCAGTTGTTGGGAAGCTAAACCAGTTGAACTGGAAGACGGTAGGCTTTTTGAATCTGATTTAGGGAATACGGATGTCAACATTTCACCAATTTCTCACACCATTGTTTCTAATTCCGAAATGGGTGGCCACAAACTCCTGTCTTCTGCTAGGGTTTCCCTCTTTTCAAAAGAATATCTTATTCAAGTTACTAG...

CDS

Download CDS FASTA

1158 bp · TkA02G560760|TK1151|CDS

ATGTGGGTGTATTACTCCCTACCCCCCACCCCACCCACCCCACCCCAAAACCCTCTGCAACTTGTAAGCAGTTGTTGGGAAGCTAAACCAGTTGAACTGGAAGACGGTAGGCTTTTTGAATCTGATTTAGGGAATACGGATGTCAACATTTCACCAATTTCTCACACCATTGTTTCTAATTCCGAAATGGGTGGCCACAAACTCCTGTCTTCTGCTAGGGTTTCCCTCTTTTCAAAAGAATATCTTATTCAAGTTACTAG...

Protein

Download Protein FASTA

385 aa · TkA02G560760|TK1151|PROTEIN

MWVYYSLPPTPPTPPQNPLQLVSSCWEAKPVELEDGRLFESDLGNTDVNISPISHTIVSNSEMGGHKLLSSARVSLFSKEYLIQVTSSNSGKLVLGLLPWDNSIAFINGIEILPVPNKQFSSKVIPIPLALAQELPTHVGFETVYRLNMGGPTLSPKNDSLWRKWESDKSFLVNPFAARNASINPSLIRYHDGVSPEIAPNLVYATAQEMADAKISFQRRRIYSHSPSININRVFLMLSAQKKLKKEDSVIWSPLPTHVG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G560760`
TK1151 ID	TkA02G560760
OH-1004 ID	LXL04_016453
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	43.600
Protein coverage (%)	TK1151 44.156 / OH-1004 20.787 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G560760

Location Chr02:144832468-144835178 (+)

Description Similar to THE1: Receptor-like protein kinase THESEUS 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54380`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	A receptor-like kinase mediates the response of Arabidopsis cells to the inhibition of cellulose synthesis.2007 · DOI: 10.1016/j.cub.2007.05.018 Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At5g61350`	Probable receptor-like protein kinase At5g61350.	No verified direct reference in this release
`At2g21480`	Probable receptor-like protein kinase At2g21480.	No verified direct reference in this release
`At4g39110`	Probable receptor-like protein kinase At4g39110.	No verified direct reference in this release
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016453 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051924 regulation of calcium ion transport Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0080147 root hair cell development Biological Process

GO:0097275 intracellular ammonium homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G21480

ath:AT3G46290

ath:AT5G54380

ath:AT5G59700

ath:AT5G61350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.330

Rank 1 · TkA02G560760 · TK1151

Cytoplasm0.286

Rank 2 · TkA02G560760 · TK1151

Cell membrane0.214

Rank 3 · TkA02G560760 · TK1151

Endoplasmic reticulum0.159

Rank 4 · TkA02G560760 · TK1151

Mitochondrion0.074

Rank 5 · TkA02G560760 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12819Malectin_like77-216 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G560760	`PF12819`	Malectin_like	77	216	4e-06	27.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK35`	Arabidopsis thaliana	sp\|Q9LK35\|THE1_ARATH Receptor-like protein kinase THESEUS 1	35.000%	Swiss-Prot	Medium
`Q9FLJ8`	Arabidopsis thaliana	sp\|Q9FLJ8\|Y5613_ARATH Probable receptor-like protein kinase At5g61350	42.000%	Swiss-Prot	Low
`Q9SJT0`	Arabidopsis thaliana	sp\|Q9SJT0\|Y2214_ARATH Probable receptor-like protein kinase At2g21480	38.200%	Swiss-Prot	Low
`Q9T020`	Arabidopsis thaliana	sp\|Q9T020\|Y4391_ARATH Probable receptor-like protein kinase At4g39110	37.800%	Swiss-Prot	Low
`Q9FN92`	Arabidopsis thaliana	sp\|Q9FN92\|Y5597_ARATH Probable receptor-like protein kinase At5g59700	36.200%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card