LXL04_016453 | RubberDandelionOmics

Gene overview

LXL04_016453

Reference: OH-1004 Chr: Chr03 Coordinates: 123665030-123667471 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2442 bp · LXL04_016453|LXL04_016453|OH1004|cDNA

ATGAGCGTTTTGATAAGGGTATCTTCTGTTCTTGTTCTTATATCTTTTTATCTTCATCAATCATCATCTGCTTCGTTCATTCCTCCTGATAACTACTTAATTTCTTGTGGTTCTTCACAAAATATCACATTTCTTGGCCAAACTTATCTCCCTGATTCGATTCAATCGTCATTTTCCCTAAAAACCCAACAAGATTCGAATATTATCAAATCGAATTCAACCGTTCCATTACCAATCCACCAATCTGCTCGAGTTTTCAC...

CDS

Download CDS FASTA

2442 bp · LXL04_016453|LXL04_016453|OH1004|CDS

ATGAGCGTTTTGATAAGGGTATCTTCTGTTCTTGTTCTTATATCTTTTTATCTTCATCAATCATCATCTGCTTCGTTCATTCCTCCTGATAACTACTTAATTTCTTGTGGTTCTTCACAAAATATCACATTTCTTGGCCAAACTTATCTCCCTGATTCGATTCAATCGTCATTTTCCCTAAAAACCCAACAAGATTCGAATATTATCAAATCGAATTCAACCGTTCCATTACCAATCCACCAATCTGCTCGAGTTTTCAC...

Protein

Download Protein FASTA

813 aa · LXL04_016453|LXL04_016453|OH1004|PROTEIN

MSVLIRVSSVLVLISFYLHQSSSASFIPPDNYLISCGSSQNITFLGQTYLPDSIQSSFSLKTQQDSNIIKSNSTVPLPIHQSARVFTTISTYIFNIKKQGRHWIRLHFYPIPDHNLTSSSFTVVTENFVLLNNYSFKSFSGSKYISKEYSINVTSNTLLLNFIPSNNSIAFINAIEVVSIPDEIIPDQAIQLSQSSPISGLSELAFETVYRLNMGGPKLTPQNDTLGRIWENDEKYLHVNSSAANVSINPSLVKYQEGVT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_016453`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_016453

Location Chr03:123665030-123667471 (-)

Description Similar to THE1: Receptor-like protein kinase THESEUS 1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g54380`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	A receptor-like kinase mediates the response of Arabidopsis cells to the inhibition of cellulose synthesis.2007 · DOI: 10.1016/j.cub.2007.05.018 Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At3g46290`	Receptor-like protein kinase required for cell elongation during vegetative growth, mostly in a brassinosteroid-(BR-) independent manner.	Three related receptor-like kinases are required for optimal cell elongation in Arabidopsis thaliana.2009 · DOI: 10.1073/pnas.0812346106
`At2g21480`	Probable receptor-like protein kinase At2g21480.	No verified direct reference in this release
`At5g61350`	Probable receptor-like protein kinase At5g61350.	No verified direct reference in this release
`At5g59700`	Probable receptor-like protein kinase At5g59700.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_016453 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0009741 response to brassinosteroid Biological Process

GO:0009826 unidimensional cell growth Biological Process

GO:0010183 pollen tube guidance Biological Process

GO:0010483 pollen tube reception Biological Process

GO:0046777 protein autophosphorylation Biological Process

GO:0050832 defense response to fungus Biological Process

GO:0051924 regulation of calcium ion transport Biological Process

GO:0080092 regulation of pollen tube growth Biological Process

GO:0080147 root hair cell development Biological Process

GO:0097275 intracellular ammonium homeostasis Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005886 plasma membrane Cellular Component

KEGG gene cross-reference

ath:AT2G21480

ath:AT3G46290

ath:AT5G54380

ath:AT5G59700

ath:AT5G61350

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.771

Rank 1 · LXL04_016453 · OH-1004

Endoplasmic reticulum0.100

Rank 2 · LXL04_016453 · OH-1004

Cytoplasm0.084

Rank 3 · LXL04_016453 · OH-1004

Lysosome / Vacuole0.072

Rank 4 · LXL04_016453 · OH-1004

Nucleus0.046

Rank 5 · LXL04_016453 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF11721.15Malectin33-163 aa

PF12819.14Malectin_like34-382 aa

PF11721.15Malectin209-344 aa

PF00069.32Pkinase486-684 aa

PF07714.24PK_Tyr_Ser-Thr487-678 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_016453	`PF11721.15`	Malectin	33	163	2.7e-12	47.7
LXL04_016453	`PF12819.14`	Malectin_like	34	382	3.3e-30	106.2
LXL04_016453	`PF11721.15`	Malectin	209	344	2.7e-12	47.7
LXL04_016453	`PF00069.32`	Pkinase	486	684	9.7e-41	140.6
LXL04_016453	`PF07714.24`	PK_Tyr_Ser-Thr	487	678	4.9e-46	157.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LK35`	Arabidopsis thaliana	Receptor-like protein kinase THESEUS 1	66.005%	Swiss-Prot	strong database homology
`Q9LX66`	Arabidopsis thaliana	Receptor-like protein kinase HERK 1	50.475%	Swiss-Prot	strong database homology
`Q9SJT0`	Arabidopsis thaliana	Probable receptor-like protein kinase At2g21480	52.094%	Swiss-Prot	strong database homology
`Q9FLJ8`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g61350	49.460%	Swiss-Prot	moderate database homology
`Q9FN92`	Arabidopsis thaliana	Probable receptor-like protein kinase At5g59700	50.244%	Swiss-Prot	strong database homology

JBrowse

View in Genome Browser

Gene Card