TkA02G558980 | RubberDandelionOmics

Gene overview

TkA02G558980

Reference: TK1151 Chr: Chr02 Coordinates: 144404179-144405441 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

744 bp · TkA02G558980|TK1151|cDNA

ATGATCGACTACGAATGTTACCAGGCACCGAAAGACACAATGCTGGACACCGCCCAATGCGCGAAGATTGCTTCCCGCAATAAGAATCTACGTATAGAAGATTACAGGTTTCTTGTAAAAACCATGGTTAATTCAGGCCTTGGTGAAGAAACTTACGGTCCAAAAAACATCATATTGGGTGAAGAACAACACCCAAAACTTGTTGATTCGCTATCAGAATTAGAAGACGTGTTCTACAACACGCTCGATAGCCTATTGGC...

CDS

Download CDS FASTA

744 bp · TkA02G558980|TK1151|CDS

ATGATCGACTACGAATGTTACCAGGCACCGAAAGACACAATGCTGGACACCGCCCAATGCGCGAAGATTGCTTCCCGCAATAAGAATCTACGTATAGAAGATTACAGGTTTCTTGTAAAAACCATGGTTAATTCAGGCCTTGGTGAAGAAACTTACGGTCCAAAAAACATCATATTGGGTGAAGAACAACACCCAAAACTTGTTGATTCGCTATCAGAATTAGAAGACGTGTTCTACAACACGCTCGATAGCCTATTGGC...

Protein

Download Protein FASTA

247 aa · TkA02G558980|TK1151|PROTEIN

MIDYECYQAPKDTMLDTAQCAKIASRNKNLRIEDYRFLVKTMVNSGLGEETYGPKNIILGEEQHPKLVDSLSELEDVFYNTLDSLLARSKISPSQIDILVVTVSLLSSTPSLTSRIINRYNMRPDIKSFNLIGMGCSASLIAIDLVQHLFKTQKRLWYVLGYMEAKKRLKKGDRILMISLGAGFKSNTCVWEVARDLDRANVWKDMIEKYPPKKTVNPYVEKYAWIHDKDIDFATHEDITKMLTGCG

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G558980`
TK1151 ID	TkA02G558980
OH-1004 ID	LXL04_012473
Relationship / confidence	Non Reciprocal Best Hit / Complex relationship
Protein identity (%)	57.900
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G558980

Location Chr02:144404179-144405441 (-)

Description Similar to KCS19: 3-ketoacyl-CoA synthase 19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04530`	3-ketoacyl-CoA synthase 19.	No verified direct reference in this release
`At1g07720`	3-ketoacyl-CoA synthase 3.	No verified direct reference in this release
`At2g28630`	3-ketoacyl-CoA synthase 12.	No verified direct reference in this release
`At1g25450`	Mediates mostly the synthesis of very-long-chain fatty acids (VLCFAs) from 26 to 30 carbons in length.	Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101
`At5g49070`	Probable 3-ketoacyl-CoA synthase 21.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012473 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000038 very long-chain fatty acid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0160062 cutin-based cuticle development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT1G01120

ath:AT1G07720

ath:AT2G28630

ath:AT2G46720

ath:AT5G04530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.344

Rank 1 · TkA02G558980 · TK1151

Cytoplasm0.231

Rank 2 · TkA02G558980 · TK1151

Peroxisome0.188

Rank 3 · TkA02G558980 · TK1151

Mitochondrion0.153

Rank 4 · TkA02G558980 · TK1151

Nucleus0.076

Rank 5 · TkA02G558980 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08392FAE1_CUT1_RppA1-156 aa

PF08541ACP_syn_III_C86-102 aa

PF08541ACP_syn_III_C163-192 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G558980	`PF08392`	FAE1_CUT1_RppA	1	156	2.8e-53	181.9
TkA02G558980	`PF08541`	ACP_syn_III_C	86	102	0.0011	19.8
TkA02G558980	`PF08541`	ACP_syn_III_C	163	192	0.0011	19.8

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ72`	Arabidopsis thaliana	sp\|Q9LZ72\|KCS19_ARATH 3-ketoacyl-CoA synthase 19	32.600%	Swiss-Prot	Medium
`Q9LQP8`	Arabidopsis thaliana	sp\|Q9LQP8\|KCS3_ARATH 3-ketoacyl-CoA synthase 3	30.900%	Swiss-Prot	Medium
`Q9SIB2`	Arabidopsis thaliana	sp\|Q9SIB2\|KCS12_ARATH 3-ketoacyl-CoA synthase 12	30.600%	Swiss-Prot	Medium
`Q9C6L5`	Arabidopsis thaliana	sp\|Q9C6L5\|KCS5_ARATH 3-ketoacyl-CoA synthase 5	35.100%	Swiss-Prot	Medium
`Q9FH27`	Arabidopsis thaliana	sp\|Q9FH27\|KCS21_ARATH Probable 3-ketoacyl-CoA synthase 21	50.000%	Swiss-Prot	Low

JBrowse

View in Genome Browser

Gene Card