LXL04_012473 | RubberDandelionOmics

Gene overview

LXL04_012473

Reference: OH-1004 Chr: Chr03 Coordinates: 12795788-12797050 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1263 bp · LXL04_012473|LXL04_012473|OH1004|cDNA

ATGATCGACTACGAATGTTACCAGGCACCGAAAGACACAATGCTGGACACCGATCAATGCGCGAAGATTGCTTCCCGCAATAAGAATCTACGTATAGAAGATTACAGGTTTCTTGTAAAAACCATGGTTAATTCAGGCCTTGGTGAAGAAACTTACGGCCCAAAAAACATCATATTGGGTGAAGAACAACACCCAAAACTTGTTGATTCGCTATCAGAATTAGAAGACGTGTTCTACAACACTCTCGATAGCCTATTGGC...

CDS

Download CDS FASTA

1263 bp · LXL04_012473|LXL04_012473|OH1004|CDS

ATGATCGACTACGAATGTTACCAGGCACCGAAAGACACAATGCTGGACACCGATCAATGCGCGAAGATTGCTTCCCGCAATAAGAATCTACGTATAGAAGATTACAGGTTTCTTGTAAAAACCATGGTTAATTCAGGCCTTGGTGAAGAAACTTACGGCCCAAAAAACATCATATTGGGTGAAGAACAACACCCAAAACTTGTTGATTCGCTATCAGAATTAGAAGACGTGTTCTACAACACTCTCGATAGCCTATTGGC...

Protein

Download Protein FASTA

420 aa · LXL04_012473|LXL04_012473|OH1004|PROTEIN

MIDYECYQAPKDTMLDTDQCAKIASRNKNLRIEDYRFLVKTMVNSGLGEETYGPKNIILGEEQHPKLVDSLSELEDVFYNTLDSLLARSKISPSQIDILVVTVSLLSSTPSLTSRIINRYNMRPDIKSFNLIGMGCSASLIAIDLVQHLFKTQKNKIAIVVSSESMASHWYCGRERSMMLSNCLFRVGGCSMLLTNDNARKNQAILKLKCIVRRHLASDDEAFNCCMQVEDDQGYGGFRLNKALPKVAARALTKNLQVML...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`LXL04_012473`
Source version	OH-1004 / GCA_047496595.1_OSU_TarKok_2.0

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · OH-1004

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID LXL04_012473

Location Chr03:12795788-12797050 (+)

Description Similar to KCS19: 3-ketoacyl-CoA synthase 19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04530`	3-ketoacyl-CoA synthase 19.	No verified direct reference in this release
`At2g28630`	3-ketoacyl-CoA synthase 12.	No verified direct reference in this release
`At1g07720`	3-ketoacyl-CoA synthase 3.	No verified direct reference in this release
`At1g01120`	Contributes to cuticular wax and suberin biosynthesis.	KCS1 encodes a fatty acid elongase 3-ketoacyl-CoA synthase affecting wax biosynthesis in Arabidopsis thaliana.1999 · DOI: 10.1046/j.1365-313x.1999.00352.x Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101 Substrate specificity of Arabidopsis 3-ketoacyl-CoA synthases.2006 · DOI: 10.1016/j.bbrc.2006.05.162
`At2g46720`	Contributes to cuticular wax and suberin biosynthesis (By similarity).	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012473 · GCA_047496595.1_OSU_TarKok_2.0.

GO annotations (OH1004 source)

GO:0000038 very long-chain fatty acid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0160062 cutin-based cuticle development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT1G01120

ath:AT1G07720

ath:AT2G28630

ath:AT2G46720

ath:AT5G04530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.716

Rank 1 · LXL04_012473 · OH-1004

Cytoplasm0.095

Rank 2 · LXL04_012473 · OH-1004

Cell membrane0.092

Rank 3 · LXL04_012473 · OH-1004

Mitochondrion0.087

Rank 4 · LXL04_012473 · OH-1004

Peroxisome0.056

Rank 5 · LXL04_012473 · OH-1004

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08392.19FAE1_CUT1_RppA1-275 aa

PF08541.17ACP_syn_III_C283-365 aa

PF02797.22Chal_sti_synt_C287-354 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
LXL04_012473	`PF08392.19`	FAE1_CUT1_RppA	1	275	5.9e-107	358.0
LXL04_012473	`PF08541.17`	ACP_syn_III_C	283	365	2.6e-10	41.0
LXL04_012473	`PF02797.22`	Chal_sti_synt_C	287	354	7.7e-10	39.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ72`	Arabidopsis thaliana	3-ketoacyl-CoA synthase 19	59.859%	Swiss-Prot	strong database homology
`Q9SIB2`	Arabidopsis thaliana	3-ketoacyl-CoA synthase 12	52.644%	Swiss-Prot	strong database homology
`Q9LQP8`	Arabidopsis thaliana	3-ketoacyl-CoA synthase 3	53.226%	Swiss-Prot	strong database homology
`Q9MAM3`	Arabidopsis thaliana	3-ketoacyl-CoA synthase 1	41.481%	Swiss-Prot	moderate database homology
`Q9ZUZ0`	Arabidopsis thaliana	3-ketoacyl-CoA synthase 13	39.303%	Swiss-Prot	moderate database homology

JBrowse

View in Genome Browser

Gene Card