TkA02G558710 | RubberDandelionOmics

Gene overview

TkA02G558710

Reference: TK1151 Chr: Chr02 Coordinates: 144354861-144357919 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1185 bp · TkA02G558710|TK1151|cDNA

ATGATTGACTACGAATGTTACCAGGCACCGAAAGACACAATGCTGGACACCGATCAATGCGCGAAGATTGCTTCCCGCAATAAGAATCTACGTATAGAAGAGTACAGGTTTCTTGTAAAAACCATGGTTAATTCAGGCCTTGGTGAAGAAACTTACGGCCCAAAAAACATCATATTGGGTGAAGAACAACACCCAAAACTTGTTGATTCGCTATCAGAATTAGAAGACGTGTTCTACAACACGCTCGATAGCCTATTGGC...

CDS

Download CDS FASTA

1185 bp · TkA02G558710|TK1151|CDS

ATGATTGACTACGAATGTTACCAGGCACCGAAAGACACAATGCTGGACACCGATCAATGCGCGAAGATTGCTTCCCGCAATAAGAATCTACGTATAGAAGAGTACAGGTTTCTTGTAAAAACCATGGTTAATTCAGGCCTTGGTGAAGAAACTTACGGCCCAAAAAACATCATATTGGGTGAAGAACAACACCCAAAACTTGTTGATTCGCTATCAGAATTAGAAGACGTGTTCTACAACACGCTCGATAGCCTATTGGC...

Protein

Download Protein FASTA

394 aa · TkA02G558710|TK1151|PROTEIN

MIDYECYQAPKDTMLDTDQCAKIASRNKNLRIEEYRFLVKTMVNSGLGEETYGPKNIILGEEQHPKLVDSLSELEDVFYNTLDSLLARSKISPSQIDILVVTVSLLSSPPSLTSRIINRYNMRPDIKSFNLIGMGCSASLIAIDMVQHLFKTLKNKIAIVVSSESMASHWYCGRERSMMLSNCIFRVGGCSMLLTNDNAQKSQAILKLKCIVRRHLASDDEAYNCCMQVEDKFDIVSFNPTEDDQGYGGFRLNKALTKVA...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G558710`
TK1151 ID	TkA02G558710
OH-1004 ID	LXL04_012473
Relationship / confidence	Rbh Below Probable Coverage Or Synteny Threshold / Review
Protein identity (%)	92.600
Protein coverage (%)	TK1151 99.746 / OH-1004 90.714 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G558710

Location Chr02:144354861-144357919 (-)

Description Similar to KCS19: 3-ketoacyl-CoA synthase 19

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g04530`	3-ketoacyl-CoA synthase 19.	No verified direct reference in this release
`At2g28630`	3-ketoacyl-CoA synthase 12.	No verified direct reference in this release
`At1g07720`	3-ketoacyl-CoA synthase 3.	No verified direct reference in this release
`At1g01120`	Contributes to cuticular wax and suberin biosynthesis.	KCS1 encodes a fatty acid elongase 3-ketoacyl-CoA synthase affecting wax biosynthesis in Arabidopsis thaliana.1999 · DOI: 10.1046/j.1365-313x.1999.00352.x Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101 Substrate specificity of Arabidopsis 3-ketoacyl-CoA synthases.2006 · DOI: 10.1016/j.bbrc.2006.05.162
`At1g04220`	Mediates the synthesis of VLCFAs from 22 to 26 carbons in length (e.g. C22, C24, C26).	Specific and differential inhibition of very-long-chain fatty acid elongases from Arabidopsis thaliana by different herbicides.2004 · DOI: 10.1073/pnas.0404600101 The DAISY gene from Arabidopsis encodes a fatty acid elongase condensing enzyme involved in the biosynthesis of aliphatic suberin in roots and the chalaza-micropyle region of seeds.2009 · DOI: 10.1111/j.1365-313x.2008.03674.x Two Arabidopsis 3-ketoacyl CoA synthase genes, KCS20 and KCS2/DAISY, are functionally redundant in cuticular wax and root suberin biosynthesis, but differentially controlled by osmotic stress.2009 · DOI: 10.1111/j.1365-313x.2009.03973.x

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012473 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000038 very long-chain fatty acid metabolic process Biological Process

GO:0006633 fatty acid biosynthetic process Biological Process

GO:0009409 response to cold Biological Process

GO:0009416 response to light stimulus Biological Process

GO:0010025 wax biosynthetic process Biological Process

GO:0030497 fatty acid elongation Biological Process

GO:0042761 very long-chain fatty acid biosynthetic process Biological Process

GO:0070417 cellular response to cold Biological Process

GO:0160062 cutin-based cuticle development Biological Process

GO:0005737 cytoplasm Cellular Component

GO:0005783 endoplasmic reticulum Cellular Component

GO:0005789 endoplasmic reticulum membrane Cellular Component

KEGG gene cross-reference

ath:AT1G01120

ath:AT1G07720

ath:AT2G28630

ath:AT2G46720

ath:AT5G04530

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Endoplasmic reticulum0.670

Rank 1 · TkA02G558710 · TK1151

Mitochondrion0.099

Rank 2 · TkA02G558710 · TK1151

Cytoplasm0.094

Rank 3 · TkA02G558710 · TK1151

Peroxisome0.079

Rank 4 · TkA02G558710 · TK1151

Cell membrane0.071

Rank 5 · TkA02G558710 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF08392FAE1_CUT1_RppA1-287 aa

PF00108Thiolase_N75-174 aa

PF08541ACP_syn_III_C86-101 aa

PF21440aSelB_III117-172 aa

PF08545ACP_syn_III134-209 aa

PF21440aSelB_III210-232 aa

PF21440aSelB_III292-335 aa

PF08541ACP_syn_III_C295-377 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G558710	`PF08392`	FAE1_CUT1_RppA	1	287	5.5e-102	341.7
TkA02G558710	`PF00108`	Thiolase_N	75	174	0.24	11.5
TkA02G558710	`PF08541`	ACP_syn_III_C	86	101	1.8e-09	38.3
TkA02G558710	`PF21440`	aSelB_III	117	172	0.25	12.1
TkA02G558710	`PF08545`	ACP_syn_III	134	209	0.024	15.2
TkA02G558710	`PF21440`	aSelB_III	210	232	0.25	12.1
TkA02G558710	`PF21440`	aSelB_III	292	335	0.25	12.1
TkA02G558710	`PF08541`	ACP_syn_III_C	295	377	1.8e-09	38.3
TkA02G558710	`PF02797`	Chal_sti_synt_C	299	357	2.8e-08	34.6

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9LZ72`	Arabidopsis thaliana	sp\|Q9LZ72\|KCS19_ARATH 3-ketoacyl-CoA synthase 19	58.000%	Swiss-Prot	High
`Q9SIB2`	Arabidopsis thaliana	sp\|Q9SIB2\|KCS12_ARATH 3-ketoacyl-CoA synthase 12	49.800%	Swiss-Prot	Medium
`Q9LQP8`	Arabidopsis thaliana	sp\|Q9LQP8\|KCS3_ARATH 3-ketoacyl-CoA synthase 3	50.400%	Swiss-Prot	High
`Q9MAM3`	Arabidopsis thaliana	sp\|Q9MAM3\|KCS1_ARATH 3-ketoacyl-CoA synthase 1	39.300%	Swiss-Prot	Medium
`Q5XEP9`	Arabidopsis thaliana	sp\|Q5XEP9\|KCS2_ARATH 3-ketoacyl-CoA synthase 2	38.800%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card