TkA02G558080 | RubberDandelionOmics

Gene overview

TkA02G558080

Reference: TK1151 Chr: Chr02 Coordinates: 144167653-144172195 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2480 bp · TkA02G558080|TK1151|cDNA

AGTAGATCATAATCATCCATTGTTTTACCCGACGCTTACCAACCCTAGATTTACGCTTTATCTTATATGAATTATTTGAACTCAAAACTATTTTGTTTCTGAATTCTGTCCACTTTTTTCGAATTTGCGTTTACTATAATTGTCGTGCGGAGGATTTGAACCGAAATTTTCGGATTTCAGCTTTGAGTCAAAGATCTGCTCTCGTATCTCCGTTATCAGCTTTAATGCTTCTGTAACGGATTTCTGACGAAAGTTTATTC...

CDS

Download CDS FASTA

1890 bp · TkA02G558080|TK1151|CDS

ATGAGGAGCGTTGGAGTGAGTACTAGTATTATTCCCGCAACAAAAGGATCCGCAGAACTCAATCACCATAAACGAAAAGAGCTCAAAGAAGTGAGAGATGGACCCGCATTCAACGGCCAAAGGCTGTCTGAAGAAGACGAGTCCAGAATCAATGAAGATGTCAATGGTAATAGGCGCATAGAGTTGGTTACTGTTCATAGACACCATCAACAACCTCAAGGACCTCTGGTTCAATGGGAGCGGTTTCTTCCCATTAGGTC...

Protein

Download Protein FASTA

629 aa · TkA02G558080|TK1151|PROTEIN

MRSVGVSTSIIPATKGSAELNHHKRKELKEVRDGPAFNGQRLSEEDESRINEDVNGNRRIELVTVHRHHQQPQGPLVQWERFLPIRSLKVLLVDDDDCTRHVVSALLRNCSYEVTAVANGLEAWKVLIDLNKQIDLVLTEVVMPYVSGIGLLTKIMNHAPRKNIPVIMMSSDDSMGIVFNCLSKGAVDFLVKPIRKNELKNLWQHVWRKCHSSSGSESESGIRAHKPINVKSDDVSDDADDDGSDDDDEDDDDDDRSIGL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G558080`
TK1151 ID	TkA02G558080
OH-1004 ID	LXL04_012489
Relationship / confidence	Rbh Sequence Supported / Probable
Protein identity (%)	94.300
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G558080

Location Chr02:144167653-144172195 (-)

Description Similar to PRR37: Two-component response regulator-like PRR37

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At5g02810`	Transcriptional repressor of CCA1 and LHY, and positive regulator of LWD1 and LWD2 expression.	Circadian waves of expression of the APRR1/TOC1 family of pseudo-response regulators in Arabidopsis thaliana: insight into the plant circadian clock.2000 · DOI: 10.1093/pcp/pcd043

Rice

Reference gene ID	Possible function	Papers / DOI
`UniProt: A2YQ93`	Controls photoperiodic flowering response.	No verified direct reference in this release
`Os07g0695100`	Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions.	Natural variation in OsPRR37 regulates heading date and contributes to rice cultivation at a wide range of latitudes.2013 · DOI: 10.1093/mp/sst088 Days to heading 7, a major quantitative locus determining photoperiod sensitivity and regional adaptation in rice.2014 · DOI: 10.1073/pnas.1418204111
`Os03g0284100`	Controls photoperiodic flowering response.	No verified direct reference in this release
`UniProt: A2XFB7`	Controls photoperiodic flowering response.	No verified direct reference in this release

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012489 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0000160 phosphorelay signal transduction system Biological Process

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0007623 circadian rhythm Biological Process

GO:0009736 cytokinin-activated signaling pathway Biological Process

GO:0010017 red or far-red light signaling pathway Biological Process

GO:0042752 regulation of circadian rhythm Biological Process

GO:0045892 negative regulation of DNA-templated transcription Biological Process

GO:0048511 rhythmic process Biological Process

GO:0005634 nucleus Cellular Component

GO:0005739 mitochondrion Cellular Component

GO:0003677 DNA binding Molecular Function

KEGG gene cross-reference

ath:AT5G02810

ath:AT5G60100

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.915

Rank 1 · TkA02G558080 · TK1151

Cytoplasm0.104

Rank 2 · TkA02G558080 · TK1151

Cell membrane0.081

Rank 3 · TkA02G558080 · TK1151

Endoplasmic reticulum0.033

Rank 4 · TkA02G558080 · TK1151

Plastid0.012

Rank 5 · TkA02G558080 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF29701TP_0454_N88-173 aa

PF00072Response_reg90-201 aa

PF04931DNA_pol_phi233-255 aa

PF28610Glycine-rich_protein_DOT1489-569 aa

PF09425Jas_motif577-601 aa

PF06203CCT578-620 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G558080	`PF29701`	TP_0454_N	88	173	0.2	12.2
TkA02G558080	`PF00072`	Response_reg	90	201	1.5e-21	77.4
TkA02G558080	`PF04931`	DNA_pol_phi	233	255	2.6	6.8
TkA02G558080	`PF28610`	Glycine-rich_protein_DOT1	489	569	0.28	11.1
TkA02G558080	`PF09425`	Jas_motif	577	601	0.00039	20.8
TkA02G558080	`PF06203`	CCT	578	620	1.9e-17	63.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q93WK5`	Arabidopsis thaliana	sp\|Q93WK5\|APRR7_ARATH Two-component response regulator-like APRR7	40.600%	Swiss-Prot	Medium
`A2YQ93`	Oryza sativa subsp. indica	sp\|A2YQ93\|PRR37_ORYSI Two-component response regulator-like PRR37	43.300%	Swiss-Prot	Medium
`Q0D3B6`	Oryza sativa subsp. japonica	sp\|Q0D3B6\|PRR37_ORYSJ Two-component response regulator-like PRR37	43.100%	Swiss-Prot	Medium
`Q10N34`	Oryza sativa subsp. japonica	sp\|Q10N34\|PRR73_ORYSJ Two-component response regulator-like PRR73	44.000%	Swiss-Prot	Medium
`A2XFB7`	Oryza sativa subsp. indica	sp\|A2XFB7\|PRR73_ORYSI Two-component response regulator-like PRR73	44.000%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card