TkA02G557420 | RubberDandelionOmics

Gene overview

TkA02G557420

Reference: TK1151 Chr: Chr02 Coordinates: 143973067-143975412 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1443 bp · TkA02G557420|TK1151|cDNA

AAATAAACACCAAAGTATAATCAGTTTGCTCCTCTCGTTCAAGGTTAACGCCATCTTATAGTCTAGCTGTCTTCTCTCTCTCACACACTAAACACACACACAAATTCCCTTCCTTTATATATTTATCTTTCAATTCACTTCTCTGATCGCTTCTTCAAATTCCGATTGATTACCGTAACTTTTACATCAACCATCGCTGTTTTTTCTGGTACCAGCCAGAGATCGTCGGAGAAAGCAATGACAATGATGACCAATGCCGG...

CDS

Download CDS FASTA

804 bp · TkA02G557420|TK1151|CDS

ATGACAATGATGACCAATGCCGGAGGAGTAGGACCCTTTGGTGACACTACGTTGACCAAAGTCTTCGTCGGAGGATTAGCATGGGAGACTCCCAAGGACGCCATGAGAGACCACTTCGAGAAATACGGCGACATTCTCGAAGCTGTCATTATCTCCGACAAAACAACCGGCCGATCCAAAGGCTATGGCTTCGTGACGTTTAAGGAGCCGGAGGCGGCGAAGAAGGCTTGCGAGGATGCGACACCGGTTATTAACGGCCG...

Protein

Download Protein FASTA

267 aa · TkA02G557420|TK1151|PROTEIN

MTMMTNAGGVGPFGDTTLTKVFVGGLAWETPKDAMRDHFEKYGDILEAVIISDKTTGRSKGYGFVTFKEPEAAKKACEDATPVINGRRANCNLASLGARRPRSLTVVPPLPPPQPQQQTGPNIIVGPRSAGTLTPPPSHVQWYYPPTPTPASPYHPHHHHQAAVPYYGYAPATYVAATDVSYNHKLGYTGGAYMNGYSHVYPSQATVGAHTLMPMYHMYQYHHQSQAMGLPAQFFCAPTSTGPMTAVPAILSKPTQIAPT...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G557420`
TK1151 ID	TkA02G557420
OH-1004 ID	LXL04_012503
Relationship / confidence	Rbh High Identity Coverage Synteny / Strict
Protein identity (%)	100.000
Protein coverage (%)	TK1151 97.753 / OH-1004 95.956 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G557420

Location Chr02:143973067-143975412 (-)

Description Similar to ARP1: Probable RNA-binding protein ARP1

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At3g54770`	Probable RNA-binding protein involved in the regulation of abscisic acid (ABA) response during seed germination.	An ABA-regulated putative RNA-binding protein affects seed germination of Arabidopsis under ABA or abiotic stress conditions.2013 · DOI: 10.1016/j.jplph.2012.09.002

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012503 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006397 mRNA processing Biological Process

GO:0008285 negative regulation of cell population proliferation Biological Process

GO:0008380 RNA splicing Biological Process

GO:0009414 response to water deprivation Biological Process

GO:0009651 response to salt stress Biological Process

GO:0009737 response to abscisic acid Biological Process

GO:0010029 regulation of seed germination Biological Process

GO:0030154 cell differentiation Biological Process

GO:0043484 regulation of RNA splicing Biological Process

GO:0051726 regulation of cell cycle Biological Process

GO:0070935 3'-UTR-mediated mRNA stabilization Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT3G54770

gga:768866

hsa:55544

xla:398603

xtr:448763

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.675

Rank 1 · TkA02G557420 · TK1151

Cytoplasm0.394

Rank 2 · TkA02G557420 · TK1151

Cell membrane0.069

Rank 3 · TkA02G557420 · TK1151

Endoplasmic reticulum0.036

Rank 4 · TkA02G557420 · TK1151

Lysosome / Vacuole0.016

Rank 5 · TkA02G557420 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF16367RRM_719-79 aa

PF00076RRM_121-78 aa

PF08777RRM_323-83 aa

PF14605Nup35_RRM_233-76 aa

PF05172RRM_Nup3537-87 aa

PF15912VIR_N106-160 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G557420	`PF16367`	RRM_7	19	79	0.0002	22.0
TkA02G557420	`PF00076`	RRM_1	21	78	8.1e-18	64.8
TkA02G557420	`PF08777`	RRM_3	23	83	0.026	15.3
TkA02G557420	`PF14605`	Nup35_RRM_2	33	76	0.02	15.5
TkA02G557420	`PF05172`	RRM_Nup35	37	87	0.14	12.9
TkA02G557420	`PF15912`	VIR_N	106	160	1.5	8.9

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9M1S3`	Arabidopsis thaliana	sp\|Q9M1S3\|ARP1_ARATH Probable RNA-binding protein ARP1	49.600%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card