TkA02G556300 | RubberDandelionOmics

Gene overview

TkA02G556300

Reference: TK1151 Chr: Chr02 Coordinates: 143612073-143615068 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

1299 bp · TkA02G556300|TK1151|cDNA

CGAAGGGTGCAATCCATTCATAAACGTTATCCTGGTGTAGAGAAGGAAGATCTAGAGTTGAATTTCTTTAGCTTATCTATAATAGCCAAGGCTACTAATAACTTCTCAATTGACAATAAACTTGGAGAAGGTGGCTTTGGTCCAGTTTACAAGGGTGTGTTGGAGACCGGACAAGAAATAGCTGTAAAGCAACTTTCAAGAACTTCTGAACAGGGGTATGACGAATTCTACAATGAAGTTGTTTATATTGCCAGACTTCA...

CDS

Download CDS FASTA

660 bp · TkA02G556300|TK1151|CDS

CGAAGGGTGCAATCCATTCATAAACGTTATCCTGGTGTAGAGAAGGAAGATCTAGAGTTGAATTTCTTTAGCTTATCTATAATAGCCAAGGCTACTAATAACTTCTCAATTGACAATAAACTTGGAGAAGGTGGCTTTGGTCCAGTTTACAAGGGTGTGTTGGAGACCGGACAAGAAATAGCTGTAAAGCAACTTTCAAGAACTTCTGAACAGGGGTATGACGAATTCTACAATGAAGTTGTTTATATTGCCAGACTTCA...

Protein

Download Protein FASTA

219 aa · TkA02G556300|TK1151|PROTEIN

RRVQSIHKRYPGVEKEDLELNFFSLSIIAKATNNFSIDNKLGEGGFGPVYKGVLETGQEIAVKQLSRTSEQGYDEFYNEVVYIARLQHRNLVKILGYCMDRDERILIYEYMSNKSLDCFLFDEIKSHMLKWPHRFSIINWIARGMLYLHQDSHLRIIHRDLKAANILLDQEMNPKISDFGLARETEENQITTKTKTTNTRLHFTRVCTSWSFLRKIGCV

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G556300`
TK1151 ID	TkA02G556300
OH-1004 ID	LXL04_012531
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	89.200
Protein coverage (%)	TK1151 88.584 / OH-1004 13.315 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G556300

Location Chr02:143612073-143615068 (-)

Description Similar to At4g27290: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At4g27290`	G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290.	No verified direct reference in this release
`At4g21390`	G-type lectin S-receptor-like serine/threonine-protein kinase B120.	No verified direct reference in this release
`At1g61490`	G-type lectin S-receptor-like serine/threonine-protein kinase At1g61490.	No verified direct reference in this release
`At1g61380`	S-domain receptor protein kinase involved in lipopolysaccharide (LPS) sensing.	A lectin S-domain receptor kinase mediates lipopolysaccharide sensing in Arabidopsis thaliana.2015 · DOI: 10.1038/ni.3124 Lipopolysaccharides Trigger Two Successive Bursts of Reactive Oxygen Species at Distinct Cellular Locations.2018 · DOI: 10.1104/pp.17.01637 Tyrosine phosphorylation of the lectin receptor-like kinase LORE regulates plant immunity.2020 · DOI: 10.15252/embj.2019102856
`At4g27300`	G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1.	No verified direct reference in this release

Rice

No hit for this species in the current source table.

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012531 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006955 immune response Biological Process

GO:0007165 signal transduction Biological Process

GO:0048544 recognition of pollen Biological Process

GO:0005576 extracellular region Cellular Component

GO:0005773 vacuole Cellular Component

GO:0005886 plasma membrane Cellular Component

GO:0009506 plasmodesma Cellular Component

GO:0009507 chloroplast Cellular Component

GO:0004674 protein serine/threonine kinase activity Molecular Function

GO:0004675 transmembrane receptor protein serine/threonine kinase activity Molecular Function

GO:0005516 calmodulin binding Molecular Function

GO:0005524 ATP binding Molecular Function

KEGG gene cross-reference

ath:AT4G21380

ath:AT4G27290

ath:AT4G27300

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cell membrane0.455

Rank 1 · TkA02G556300 · TK1151

Cytoplasm0.404

Rank 2 · TkA02G556300 · TK1151

Nucleus0.246

Rank 3 · TkA02G556300 · TK1151

Endoplasmic reticulum0.047

Rank 4 · TkA02G556300 · TK1151

Golgi apparatus0.044

Rank 5 · TkA02G556300 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF07714PK_Tyr_Ser-Thr36-202 aa

PF00069Pkinase36-196 aa

PF03109ABC144-65 aa

PF01163RIO149-89 aa

PF03109ABC1103-191 aa

PF01636APH147-181 aa

PF19974TCAD9149-183 aa

PF12330Haspin_kinase151-191 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G556300	`PF07714`	PK_Tyr_Ser-Thr	36	202	2.4e-37	129.4
TkA02G556300	`PF00069`	Pkinase	36	196	3.2e-35	122.5
TkA02G556300	`PF03109`	ABC1	44	65	3.2e-06	27.2
TkA02G556300	`PF01163`	RIO1	49	89	0.024	15.0
TkA02G556300	`PF03109`	ABC1	103	191	3.2e-06	27.2
TkA02G556300	`PF01636`	APH	147	181	0.04	14.4
TkA02G556300	`PF19974`	TCAD9	149	183	0.18	11.7
TkA02G556300	`PF12330`	Haspin_kinase	151	191	0.017	14.9
TkA02G556300	`PF01163`	RIO1	153	188	0.024	15.0

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`O81832`	Arabidopsis thaliana	sp\|O81832\|Y4729_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290	66.700%	Swiss-Prot	High
`O81906`	Arabidopsis thaliana	sp\|O81906\|B120_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase B120	66.700%	Swiss-Prot	High
`O64770`	Arabidopsis thaliana	sp\|O64770\|Y1649_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At1g61490	59.600%	Swiss-Prot	High
`O64782`	Arabidopsis thaliana	sp\|O64782\|SD129_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD1-29	60.000%	Swiss-Prot	High
`O81833`	Arabidopsis thaliana	sp\|O81833\|SD11_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1	62.900%	Swiss-Prot	High

JBrowse

View in Genome Browser

Gene Card