TkA02G553270 | RubberDandelionOmics

Gene overview

TkA02G553270

Reference: TK1151 Chr: Chr02 Coordinates: 142781606-142782513 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

682 bp · TkA02G553270|TK1151|cDNA

GTTCAGTTGGAGAGGAGTCACATTTAGCCATTGAGACAAGTGGGCATGGAGCACTCAAGGAGAATCACTGGCTTGACGATGGTGCATATCTTATGGTGAAGATATTGAACAAACTTGCATCAGCTAGAGCTTCAGGTCAAACAGGTGGTAGCAAAGTTTTGACCGATTTAGTTGAGGAACTACAGGAACCGGGTGTTGCTGTTGAACTTAGGTTAAAAATAGATCAAAATCATGAAGATCTCAAAGGAAGATCTTTCCAA...

CDS

Download CDS FASTA

441 bp · TkA02G553270|TK1151|CDS

ATGGTGAAGATATTGAACAAACTTGCATCAGCTAGAGCTTCAGGTCAAACAGGTGGTAGCAAAGTTTTGACCGATTTAGTTGAGGAACTACAGGAACCGGGTGTTGCTGTTGAACTTAGGTTAAAAATAGATCAAAATCATGAAGATCTCAAAGGAAGATCTTTCCAAGAGTATGGGAACGCGGTGCTAAAGCATTTGGAAAACAAAAGTGATTCAGACCCGAAGCTTGAAAAAGCACGTGTTAATTATGAAGGGGTAAG...

Protein

Download Protein FASTA

146 aa · TkA02G553270|TK1151|PROTEIN

MVKILNKLASARASGQTGGSKVLTDLVEELQEPGVAVELRLKIDQNHEDLKGRSFQEYGNAVLKHLENKSDSDPKLEKARVNYEGVRVSGYGGWFLLRLSLHDPVLPLNIEAPSNEEVVKLGLAVLASVNEFSALDVSALTKFVHK

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G553270`
TK1151 ID	TkA02G553270
OH-1004 ID	LXL04_012560
Relationship / confidence	Sequence Supported Annotation Or Model Conflict / Review
Protein identity (%)	98.600
Protein coverage (%)	TK1151 100.000 / OH-1004 23.817 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID	`TkA02G553270`
Location	Chr02:142781606-142782513 (+)
Description	Similar to algC: Phosphomannomutase/phosphoglucomutase (Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)
Arabidopsis / Rice Reference Genes and Papers	Download references for this gene Arabidopsis No hit for this species in the current source table. Rice No hit for this species in the current source table.
Functional annotation source	View annotation sources Functional annotation source: OH1004 · `LXL04_012560` · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.
GO annotations (OH1004 source)	GO:0006006 glucose metabolic process Biological Process GO:0009298 GDP-mannose biosynthetic process Biological Process GO:0042121 alginic acid biosynthetic process Biological Process GO:0005737 cytoplasm Cellular Component GO:0000287 magnesium ion binding Molecular Function GO:0004614 phosphoglucomutase activity Molecular Function GO:0004615 phosphomannomutase activity Molecular Function
KEGG gene cross-reference	nma:NMA1001 nme:NMB0790 ppu:PP_5288 pst:PSPTO_0083 These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Cytoplasm0.720

Rank 1 · TkA02G553270 · TK1151

Nucleus0.324

Rank 2 · TkA02G553270 · TK1151

Mitochondrion0.104

Rank 3 · TkA02G553270 · TK1151

Peroxisome0.079

Rank 4 · TkA02G553270 · TK1151

Endoplasmic reticulum0.051

Rank 5 · TkA02G553270 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF00408PGM_PMM_IV77-119 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G553270	`PF00408`	PGM_PMM_IV	77	119	0.052	14.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

No result was found for this query.

JBrowse

View in Genome Browser

Gene Card