RubberDandelionOmics Rubber Dandelion Multi-omics Website
More
Transcriptome Expression Annotation Rubber Pathway TF Prediction Targets Protein Network Resequencing Tools Downloads
ZH EN

How to use this page

Gene Card

Enter a TK1151 or OH-1004 gene ID to view sequences, annotations and analyses in the corresponding reference genome.
Flanking length, max 10000 bp
Examples TkA01G624900 LXL04_000258

Gene overview

TkA02G547480
Reference: TK1151 Chr: Chr02 Coordinates: 141273796-141277401 Strand: + Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

Download cDNA FASTA

2348 bp · TkA02G547480|TK1151|cDNA

CCACGCCTCGTTTGATTTGGTCCGAACCCATTTCGACTGCCTTCAGTTTCCTTTTTAGATTTAGTCCAGCTCATCCTCCACGTCACCACGATAACCGGTCCACGTACAATAACAATTATACGTGGATCCCCAATCGCCCAATGAATATAACCTTCAGTTCAAGTAATGTGACATGTAGGATCTCATAAAATCTTCTTTCTTTGTAGTCCTTGGATTAATTCACGTTCAAGTTATCAGTCCCTTTGTTTTCTAAACCAGTC...

CDS

Download CDS FASTA

1605 bp · TkA02G547480|TK1151|CDS

ATGACCAACAGCCAAGAAGGAAGCAAGGGTCAACAGGTGAACAATCATGTGAAATCTGAGTATCAGAAAGATGTGAATAGATTTCCAAGTATCACACCAAGTTCACAAAAAGATGATGAAAATCTGCATAACGAATCCAATCAGGTGGCCCCACCACAACAGCTTCAAGGGTCATTGGTCCACTGGGAGAGGTTTCTCCATGTTAGATCCATTAAGGTCATGTTGGTAGAAGATGATGACTGTACACGCCAAATTGTAAC...

Protein

Download Protein FASTA

534 aa · TkA02G547480|TK1151|PROTEIN

MTNSQEGSKGQQVNNHVKSEYQKDVNRFPSITPSSQKDDENLHNESNQVAPPQQLQGSLVHWERFLHVRSIKVMLVEDDDCTRQIVTALLRNCNYEVIQAANGIQAWKILQNLSNHIDIVLTEVVMPCLSGIGLLCKIMSHKTRKNIPVIMMSSHDSMSLVFKCLSKGAVDFLVKPIRKNELKILWQHVWRRCHSSSGSGSESGTHAQKSVTSKGNLRYDNNSSKDGDDDNESDDGSGTQSTWTKTPSNQISELPDSTCG...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

Download Gene (CDS) Download Protein

ID Mapping

Input IDTkA02G547480
TK1151 IDTkA02G547480
OH-1004 IDLXL04_012645
Relationship / confidenceRbh High Identity Coverage Synteny / Strict
Protein identity (%)95.500
Protein coverage (%)TK1151 100.000 / OH-1004 100.000
Coverage and evidence

Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.

Source versionTK1151 / GWHBCHF00000000
Open Full ID Mapping
SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene IDTkA02G547480
LocationChr02:141273796-141277401 (+)
DescriptionSimilar to APRR7: Two-component response regulator-like APRR7
Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene IDPossible functionPapers / DOI
At5g02810 Transcriptional repressor of CCA1 and LHY, and positive regulator of LWD1 and LWD2 expression.
Circadian waves of expression of the APRR1/TOC1 family of pseudo-response regulators in Arabidopsis thaliana: insight into the plant circadian clock.2000 · DOI: 10.1093/pcp/pcd043
At5g60100 Controls photoperiodic flowering response.
Circadian waves of expression of the APRR1/TOC1 family of pseudo-response regulators in Arabidopsis thaliana: insight into the plant circadian clock.2000 · DOI: 10.1093/pcp/pcd043

Rice

Reference gene IDPossible functionPapers / DOI
Os03g0284100 Controls photoperiodic flowering response. No verified direct reference in this release
UniProt: A2XFB7 Controls photoperiodic flowering response. No verified direct reference in this release
UniProt: A2YQ93 Controls photoperiodic flowering response. No verified direct reference in this release
Functional annotation source
View annotation sources

Functional annotation source: OH1004 · LXL04_012645 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)
GO:0000160 phosphorelay signal transduction system Biological Process
GO:0006351 DNA-templated transcription Biological Process
GO:0006355 regulation of DNA-templated transcription Biological Process
GO:0007623 circadian rhythm Biological Process
GO:0009736 cytokinin-activated signaling pathway Biological Process
GO:0010017 red or far-red light signaling pathway Biological Process
GO:0045892 negative regulation of DNA-templated transcription Biological Process
GO:0048511 rhythmic process Biological Process
GO:0005634 nucleus Cellular Component
GO:0005739 mitochondrion Cellular Component
GO:0003677 DNA binding Molecular Function
KEGG gene cross-reference
ath:AT5G02810
dosa:Os03g0284100
These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.
Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene
Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.892
Rank 1 · TkA02G547480 · TK1151
Cytoplasm0.130
Rank 2 · TkA02G547480 · TK1151
Cell membrane0.065
Rank 3 · TkA02G547480 · TK1151
Endoplasmic reticulum0.027
Rank 4 · TkA02G547480 · TK1151
Plastid0.012
Rank 5 · TkA02G547480 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF12827Peroxin-2240-122 aa
PF29701TP_0454_N71-159 aa
PF00072Response_reg73-183 aa
PF04360Serglycin193-221 aa
PF11596DUF3246194-284 aa
PF12827Peroxin-22255-279 aa
PF04360Serglycin436-462 aa
PF06203CCT483-524 aa
Gene IDDomain IDDomain NameStart aaEnd aaE-valueScore
TkA02G547480PF12827Peroxin-22401220.04714.2
TkA02G547480PF29701TP_0454_N711590.002818.2
TkA02G547480PF00072Response_reg731834.3e-2279.1
TkA02G547480PF04360Serglycin1932211.39.7
TkA02G547480PF11596DUF32461942840.0513.8
TkA02G547480PF12827Peroxin-222552790.04714.2
TkA02G547480PF04360Serglycin4364621.39.7
TkA02G547480PF06203CCT4835246.8e-1658.7

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

ProteinOrganismDescriptionIdentityDatabaseConfidence
Q93WK5Arabidopsis thalianasp|Q93WK5|APRR7_ARATH Two-component response regulator-like APRR770.700%Swiss-ProtLow
Q9LVG4Arabidopsis thalianasp|Q9LVG4|APRR3_ARATH Two-component response regulator-like APRR339.900%Swiss-ProtMedium
Q10N34Oryza sativa subsp. japonicasp|Q10N34|PRR73_ORYSJ Two-component response regulator-like PRR7335.200%Swiss-ProtMedium
A2XFB7Oryza sativa subsp. indicasp|A2XFB7|PRR73_ORYSI Two-component response regulator-like PRR7335.200%Swiss-ProtMedium
A2YQ93Oryza sativa subsp. indicasp|A2YQ93|PRR37_ORYSI Two-component response regulator-like PRR3733.800%Swiss-ProtMedium

JBrowse

View in Genome Browser