TkA02G547140 | RubberDandelionOmics

Gene overview

TkA02G547140

Reference: TK1151 Chr: Chr02 Coordinates: 141194895-141198162 Strand: - Type: protein_coding

cDNA / CDS / Protein Sequences

Available sequence downloads CDS FASTA Protein FASTA cDNA FASTA

cDNA

2299 bp · TkA02G547140|TK1151|cDNA

TTCGTTCACTATCAGCAAACATACACATTCTCTCTCTAGAAAAAAAAAATCCCTCTCTCGAAAATGGAAGCAGACAACCGCCGGCTTTAATTCCGTCGCCGACTGCCTGTATCTCTCTCTTCATCCGATCAAGTTTGAAAAGTAAACTTGAAGCTGAATTTTGAGGAGAATTGAAGTGATGTTGGACCTTAATCTGAGTGTTGATCAGAGCGGTTTGATGTCAAAATATGCAGAGGACGATAGCGGTAAGCAGCTTCTCG...

CDS

Download CDS FASTA

1383 bp · TkA02G547140|TK1151|CDS

ATGTTGGACCTTAATCTGAGTGTTGATCAGAGCGGTTTGATGTCAAAATATGCAGAGGACGATAGCGGTAAGCAGCTTCTCGAGGTATGCGGCAGCGGCGGTCAGTTGGAACACTCCGGCGGTACCTCGAATTCCTCCGTCGTCAATGTAGAGATATCGAGTAACGCTGGCGATGAGGAGCACTCGTACTCATGTCCAGATTTCGCTTATAGCTTCGATATATTGAAACCTGGTCACCGAGAAGATAATCAGAATTTTAG...

Protein

Download Protein FASTA

460 aa · TkA02G547140|TK1151|PROTEIN

MLDLNLSVDQSGLMSKYAEDDSGKQLLEVCGSGGQLEHSGGTSNSSVVNVEISSNAGDEEHSYSCPDFAYSFDILKPGHREDNQNFRSGSVVTKQFFPETDGDEGLQQHQLLEAVNGSAVDERDFMLRQQHKQQVRKSRRGPRPRSSQYRGVTFYRRTGRWESHIWDSGKQVYLGGFDTAHAAARAYDRAAIKFRGVDADINFNIIDYEDDLKQIKNLTKEEFVHILRRQSTGFSRGSSKYRGVTLHKCGRWEARMGQFL...

Flanking Sequence Download

Sequence orientation and download details

Upstream/downstream are capped at 10000 bp per side. Negative-strand genes are reverse-complemented so the final FASTA follows transcriptional 5′→3′ orientation.

ID Mapping

Input ID	`TkA02G547140`
TK1151 ID	TkA02G547140
OH-1004 ID	LXL04_012653
Relationship / confidence	Multi Source To Oh1004 / Complex relationship
Protein identity (%)	99.100
Protein coverage (%)	TK1151 100.000 / OH-1004 100.000 Coverage and evidence Coverage is the aligned span of the best-scoring HSP divided by representative protein length. A homolog match does not establish functional validation.
Source version	TK1151 / GWHBCHF00000000

Open Full ID Mapping

SNP / Indel variants and carrier samplesCRA009020 · TK1151

Expand to load variant records for this gene.

Basic Information and Functional Annotation

Gene ID TkA02G547140

Location Chr02:141194895-141198162 (-)

Description Similar to AP2-2: APETALA2-like protein 2

Arabidopsis / Rice Reference Genes and Papers

Download references for this gene

Arabidopsis

Reference gene ID	Possible function	Papers / DOI
`At2g28550`	Probably acts as a transcriptional activator.	No verified direct reference in this release

Rice

Reference gene ID	Possible function	Papers / DOI
`Os07g0235800`	Probable transcription factor (By similarity).	OsMADS1 Represses microRNA172 in Elongation of Palea/Lemma Development in Rice.2016 · DOI: 10.3389/fpls.2016.01891
`UniProt: B8B8J2`	Probable transcription factor (By similarity).	No verified direct reference in this release
`UniProt: B8AMA9`	Probable transcription factor (By similarity).	No verified direct reference in this release
`Os03g0818800`	Probable transcription factor (By similarity).	Two AP2 family genes, supernumerary bract (SNB) and Osindeterminate spikelet 1 (OsIDS1), synergistically control inflorescence architecture and floral meristem establishment in rice.2012 · DOI: 10.1111/j.1365-313x.2011.04804.x OsMADS1 Represses microRNA172 in Elongation of Palea/Lemma Development in Rice.2016 · DOI: 10.3389/fpls.2016.01891

Functional annotation source

View annotation sources

Functional annotation source: OH1004 · LXL04_012653 · GCA_047496595.1_OSU_TarKok_2.0. These OH1004 annotations are retrieved through ID mapping; the Arabidopsis/rice table below uses protein alignments from the query reference.

GO annotations (OH1004 source)

GO:0006351 DNA-templated transcription Biological Process

GO:0006355 regulation of DNA-templated transcription Biological Process

GO:0009908 flower development Biological Process

GO:0009909 regulation of flower development Biological Process

GO:0010073 meristem maintenance Biological Process

GO:0010093 specification of floral organ identity Biological Process

GO:0010228 vegetative to reproductive phase transition of meristem Biological Process

GO:0030154 cell differentiation Biological Process

GO:0048316 seed development Biological Process

GO:0048481 plant ovule development Biological Process

GO:0080050 regulation of seed development Biological Process

GO:0005634 nucleus Cellular Component

KEGG gene cross-reference

ath:AT4G36920

dosa:Os07g0235800

osa:4334582

osa:4342787

These KEGG gene identifiers are linked through homologous proteins; they do not establish pathway function for this gene.

Open Annotation Module

Gene expression

View expression in different studies, tissues and treatments. Results are presented separately by study and measurement unit.

View expression for this gene

Data sources and gene correspondence

Expression data come from public transcriptome studies. Reference genomes, sample metadata and measurement units are shown with the results. Ambiguous cross-reference correspondences do not select an expression record automatically; missing values do not mean zero expression.

Subcellular Localization Top 5

Computational predictions or homology annotations below do not replace localization experiments.

Nucleus0.968

Rank 1 · TkA02G547140 · TK1151

Cytoplasm0.075

Rank 2 · TkA02G547140 · TK1151

Cell membrane0.027

Rank 3 · TkA02G547140 · TK1151

Plastid0.018

Rank 4 · TkA02G547140 · TK1151

Endoplasmic reticulum0.018

Rank 5 · TkA02G547140 · TK1151

LocPro · Direct prediction · Computational prediction, not experimental localization

Open Subcellular Module

Predicted Functional Domains

Domain results are from Pfam-A/HMMER; positions are amino-acid coordinates on the protein sequence.

PF02894GFO_IDH_MocA_C26-119 aa

PF00847AP2148-196 aa

PF00847AP2239-289 aa

PF28047HrpE-like317-357 aa

PF02894GFO_IDH_MocA_C343-357 aa

PF28047HrpE-like414-437 aa

PF27961CSNKA2IP417-442 aa

Gene ID	Domain ID	Domain Name	Start aa	End aa	E-value	Score
TkA02G547140	`PF02894`	GFO_IDH_MocA_C	26	119	0.039	14.5
TkA02G547140	`PF00847`	AP2	148	196	7e-21	75.0
TkA02G547140	`PF00847`	AP2	239	289	7e-21	75.0
TkA02G547140	`PF28047`	HrpE-like	317	357	0.16	13.1
TkA02G547140	`PF02894`	GFO_IDH_MocA_C	343	357	0.039	14.5
TkA02G547140	`PF28047`	HrpE-like	414	437	0.16	13.1
TkA02G547140	`PF27961`	CSNKA2IP	417	442	4.8	7.3

Arabidopsis / Rice Protein Homology

Only Arabidopsis and rice are shown. Swiss-Prot entries are reviewed; TrEMBL entries are supplementary sequence candidates. Similarity is not experimental validation.

Download current result

Protein	Organism	Description	Identity	Database	Confidence
`Q9SK03`	Arabidopsis thaliana	sp\|Q9SK03\|RAP27_ARATH Ethylene-responsive transcription factor RAP2-7	49.500%	Swiss-Prot	Medium
`Q8H443`	Oryza sativa subsp. japonica	sp\|Q8H443\|AP23_ORYSJ APETALA2-like protein 3	54.500%	Swiss-Prot	High
`B8B8J2`	Oryza sativa subsp. indica	sp\|B8B8J2\|AP23_ORYSI APETALA2-like protein 3	62.900%	Swiss-Prot	Medium
`B8AMA9`	Oryza sativa subsp. indica	sp\|B8AMA9\|AP22_ORYSI APETALA2-like protein 2	60.500%	Swiss-Prot	Medium
`Q84TB5`	Oryza sativa subsp. japonica	sp\|Q84TB5\|AP22_ORYSJ APETALA2-like protein 2	60.500%	Swiss-Prot	Medium

JBrowse

View in Genome Browser

Gene Card